KEGG   Rhizobium tropici: RTCIAT899_PC02370Help
Entry
RTCIAT899_PC02370 CDS       T02432                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)(dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rtr  Rhizobium tropici
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTCIAT899_PC02370
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTCIAT899_PC02370
  Amino acid metabolism
   00310 Lysine degradation
    RTCIAT899_PC02370
Enzymes [BR:rtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RTCIAT899_PC02370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:complement(522716..523933)
Genome map
AA seq 405 aa AA seqDB search
MTGIIEITAPIEQEGTKAVVRNWLKRIGDHVREGDALVELETDKVTQEIAAPCDGILSEI
AMSDGDNAMPGAILGRMRAESANGVAAQAAEAPSQIQPASPATASAAAYYSPAVRKAAEE
YGIDPASLKGSGRDGRVTRADMDHALETAKPHPSAPVSQRVETGQTPPAVAADGKSRIVP
HSAMRLSIARHMAQSLATAPQVTAIFEADFTAIMRHRESNKARLKAEGVNLSYTAYFVAA
SVAAMKLVPEVNSQWHDDSLEIFEDINIGISIALGDKGLVAPIIRQAQNLQLEAIAARLQ
DLTDRARSNALKADDMKGGTFTISNHGVSGSLVASPIIINQPQSAILGIGKLEKRVIVRE
VDGADTIQIRPMAYVSLTIDHRSLDGHQTNAWLSEFVRVLQDWPQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgactggtatcattgagatcacggctccgatcgaacaggaaggcacgaaggcggttgtc
cgcaactggctgaaacggattggcgatcatgtgcgggaaggtgatgccctcgtcgaactg
gaaacggacaaggtcacccaagagatagcggctccttgcgacggtattctgagcgaaatt
gccatgtcggatggcgacaacgctatgcctggggcgatcctgggacgaatgcgtgccgag
agcgcaaacggcgttgcagcgcaagcggccgaggctccgtcgcagatacagccggcctca
cctgccacggcctccgccgccgcttattattcacctgccgttcgcaaggcagccgaggaa
tacgggatcgacccggccagtctgaaaggcagcggcagagatgggcgagtcacacgcgcc
gatatggatcatgcgctagaaaccgccaagccgcatccatccgcgccggtgtcgcaacgg
gtcgagacggggcagaccccgccggcggtcgcagctgacggcaaatctcggatcgttccc
cattcggccatgcggctttcgatcgcaaggcacatggctcaatcattggcgacggcaccg
caggtcaccgcgatcttcgaggcggatttcacggcaatcatgcgccatcgcgaaagcaac
aaggcccgactgaaggccgaaggcgtgaacctatcctatactgcctatttcgtggcggca
tcggttgcggccatgaaactcgtccccgaagtcaacagccaatggcatgatgacagtctc
gagatcttcgaagatatcaatatcgggatcagcatcgcattgggcgacaagggcctggtc
gcgccgatcattcggcaggcgcagaatctccagcttgaggcgattgccgcaaggctccag
gatctgacggaccgggcgcgatccaatgcgctcaaggccgatgatatgaaaggcggaacc
ttcacgatctccaatcatggcgtttccggctcgctggtcgcatctcccatcatcatcaac
cagccgcaatccgccatcctcggcatcggcaagctggagaagcgtgtcatcgttcgggag
gtcgatggggccgatacgatccagatccgcccgatggcctatgtgtccctgacgattgac
catcgctccctggacggtcaccagacgaacgcgtggttgtcggaattcgtgcgggttttg
caggattggccgcaatag

DBGET integrated database retrieval system