KEGG   Rhizobium tropici: RTCIAT899_PC02740Help
Entry
RTCIAT899_PC02740 CDS       T02432                                 

Definition
putative endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rtr  Rhizobium tropici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rtr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:590805..591932
Genome map
AA seq 375 aa AA seqDB search
MGRGLRSTLISRRSALKLGGGSILAALPAARAARAAAKPIVPSRGINLPGWFDRGDGVAP
SEPVLEKLRQLGFQTIRLPINGDLLSAGDTTTLRRIEAGVADLNRLGFSVLADMHPSESL
HTALRQDFEAGSQRAAEAWMALGSVLANLPNEMVYAELLNEPPLRNDAWLQLRQRLAEVV
RSKCPNHTLIWGPSPSQGIWEIGETPPLADDNQIAAIHFYSPTAFTHQCETWDASPLARI
SNLPFPATIETPLVQQSIQKLRASGDEQAASLIEEQMATPWTEAAIAAEFMKLRRWSETY
DCPVMMNEFGVLNFCVDAESRRFWVRAVRQAAESNKIGWAYWELDQGFGIIRSRGSIEGF
DDAMIAALLDDSNGG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggggcgcggcttgcgatcgacgctgatatcacgccgaagcgctctcaagctggggggc
ggctccattctggctgctcttccggctgcccgcgcggcgcgtgcggcggccaagcccatc
gtgccttcgcgcggcatcaatctgcccggatggttcgatcgcggcgatggcgtggcgcca
agcgagcctgtgctcgaaaagcttcgccaattgggctttcaaacgatccgtttgccgatc
aatggcgatctcttgtcggcaggtgatacgaccaccctccgtcgcatcgaggctggcgtg
gccgacctcaatcggctgggcttctccgtccttgccgacatgcatccctccgaaagtctg
catacggctctccgtcaggatttcgaggccggttctcaaagggcggccgaggcatggatg
gcgctaggcagcgtccttgcgaacctcccgaatgagatggtctatgcagaattgttgaac
gagccgcctctgcggaatgacgcgtggcttcagctaaggcaacggcttgccgaggtcgtg
cgatcgaaatgtcctaaccatacgctgatctgggggccatcaccctctcagggcatctgg
gaaataggcgagacgcccccgcttgcagacgataatcagatcgctgccattcatttctat
tcaccgacggccttcactcatcaatgcgagacctgggatgcgtcgccgctggcacggatt
tcgaatttgccctttcccgcgaccatcgagacgccgctggtacagcagagcatccaaaag
ctgcgagcgtccggggacgagcaggcggcaagccttatcgaggaacaaatggcgacaccc
tggacggaggctgcgatcgccgccgaatttatgaaattgaggcgctggtccgagacatat
gactgccctgtcatgatgaacgaatttggcgtcctcaacttctgcgtcgacgccgaaagt
cgccgtttctgggttcgggccgtgcggcaggcggccgagagcaacaagatcggctgggcc
tattgggagctcgatcaaggttttggcatcatcaggagcagaggcagcattgaaggcttc
gatgacgccatgatcgcggcacttctggatgacagcaatgggggctga

DBGET integrated database retrieval system