KEGG   Rhizobium tropici: RTCIAT899_PC03535Help
Entry
RTCIAT899_PC03535 CDS       T02432                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rtr  Rhizobium tropici
Pathway
rtr00630  Glyoxylate and dicarboxylate metabolism
rtr01100  Metabolic pathways
rtr01110  Biosynthesis of secondary metabolites
rtr01120  Microbial metabolism in diverse environments
rtr01200  Carbon metabolism
Module
rtr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RTCIAT899_PC03535 (aceA)
Enzymes [BR:rtr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RTCIAT899_PC03535 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGB74507
UniProt: L0LTF0
Position
pRtrCIAT899c:complement(759021..760310)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPSAPAGRFDGIERPYQAADVERLRGSVTIRHSLAEMGANRLWQLIHEEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGVPTLVVARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPSIARAVAYAPHCDLIWCETSKPDLEQARKFAEGVHRV
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNFGMFELARG
YKARQMAAYSELQEAEFVAEANGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacaaactggttcccagcgcgcctgccgggcgtttcgacggtatcgag
cgcccttatcaggccgcggatgtggagcggttgcgcggctcggttaccatccggcattca
ttggccgagatgggcgcgaaccggctctggcagctcattcacgaggaggatttcgtcaat
gcgcttggtgcgctttcgggcaatcaggccatgcagatggttcgcgccggtctgaaggcg
atctatctctcggggtggcaggttgccgccgacgccaatacggcctcggccatgtacccc
gaccaatcgctctatcctgccaacgcaggcccggagctggcgaagcgcatcaatcgcacg
ctgcaacgcgccgaccagatcgagactgccgaaggcaaagggctttccgtcgacacatgg
tttgccccgattgtcgctgatgccgaagcaggctttggcggccccctcaacgctttcgag
atcatgaaggcctatatcgaggcgggtgccgcaggcgtccattttgaggatcagttggca
tcggagaagaaatgcggtcaccttggcggcaaggtcctcattccgacggcggctcatatc
cgcaatctcaacgcggcgcggcttgctgccgacgtcatgggcgtgccgaccctcgtggtt
gcgcgtaccgacgccgaggccgccaaacttctaacctcggacatcgatgagcgcgatcag
cccttcgtcgactacgacgcgggccgcacggttgaaggcttctatcaggtcaggaacggc
atcgaacccagcatcgcccgtgctgtcgcctatgcgccgcattgcgacctcatctggtgc
gagacctcgaagccggatctggagcaggcgcgtaaatttgccgaaggcgtgcatcgggtc
catcccggcaagctgctggcttacaattgctcgccgtccttcaactggaagaagaacctg
gatgacgcgacgatcgccaagttccagcgcgagctgggtgcgatgggctacaagttccag
ttcatcacgcttgccggcttccaccaactgaatttcggcatgttcgagctcgcccgcggc
tacaaggctcgccagatggccgcttactccgagctgcaggaagccgaatttgtggccgag
gccaatggctacaccgccaccaagcaccagcgcgaagtgggcaccggctatttcgatgcg
gtctcgctggcgatcaccggcggccagtcatcgacaacggccatgcacggatcgaccgag
catgcccaattcaagccggcagcagagtga

DBGET integrated database retrieval system