KEGG   Rhizobium tropici: RTCIAT899_PC04125Help
Entry
RTCIAT899_PC04125 CDS       T02432                                 

Definition
glutathione S-transferase protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rtr  Rhizobium tropici
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rtr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:875747..876484
Genome map
AA seq 245 aa AA seqDB search
MAYELYYWDGIQGRGEFVRLALEEAGAEYVDVCRGPASKGQGMPAMFAIMGGKSDFDLPF
APPFLKDGDLIIPHVANILMYLGPKLGLAPRDEGKRHVLNGLQLTITDLVAEVHDTHHPI
ATSKYYEDQKQEAKARAAEFIENRIPKFLGYFEKVLQQNPEGSSHIFGNELTYVDLSLFQ
VYEGLHYAFPRATKHFERDYPHLTALHAAVMKRPNIARYLQSDRRIPFNENGIFRHYPEL
DKDVA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaactctattattgggatggcattcaagggcgcggcgaattcgttcggctg
gcgctggaggaggcgggtgcggagtatgtcgatgtttgtcgcggaccggcaagcaagggg
cagggaatgcccgccatgttcgccatcatgggcggaaaatccgacttcgatcttccgttt
gcgccgccatttctgaaggatggcgatctcatcattccgcatgtggcgaatatcctgatg
tatctcggcccgaaactaggtctggcaccgagggacgaaggaaagcgccacgtgttgaac
ggcctgcagttgaccatcaccgatctcgtcgccgaggtacacgacacacatcacccgatc
gcaacgtcgaaatattacgaggaccagaagcaagaggccaaagcgcgcgctgcagaattc
atcgaaaaccgcattcccaagtttctcggctatttcgagaaagtgcttcagcagaacccc
gaaggatcgagccatatcttcggaaatgaattgacctatgtcgatctatcgctgttccag
gtctatgagggattgcactatgccttcccgcgcgcgacaaagcattttgagcgcgattat
ccgcatctgactgcgctgcatgcagctgtcatgaaacggcccaacattgctcgctatctt
cagtccgatcgccgcattcccttcaatgagaacggcattttccggcactatccggaactg
gacaaagatgtggcctga

DBGET integrated database retrieval system