KEGG   Rhizobium tropici: RTCIAT899_PC05260Help
Entry
RTCIAT899_PC05260 CDS       T02432                                 

Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rtr  Rhizobium tropici
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTCIAT899_PC05260
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RTCIAT899_PC05260
   00052 Galactose metabolism
    RTCIAT899_PC05260
   00500 Starch and sucrose metabolism
    RTCIAT899_PC05260
   00520 Amino sugar and nucleotide sugar metabolism
    RTCIAT899_PC05260
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RTCIAT899_PC05260
   00524 Butirosin and neomycin biosynthesis
    RTCIAT899_PC05260
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RTCIAT899_PC05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:complement(1115506..1116948)
Genome map
AA seq 480 aa AA seqDB search
MADIAIGVDIGGTNIRAALVSVQGEILAKVSERTPTDPLLALERVIAMARALDTPEVLGI
GVGIPGRVDVDSREILSGGILNLSGLDFVRRIEAALGKPVVIENDCSMALIAEMRIGGAK
GYQNVAMLTIGTGIGGAVAHAGRIYHGHKAAGQLGHICVSQDGPPCPCGRRGCVETFSSG
TALRRHIAEAGLSVVTIKEVFDMAAEGDDAAVRVLRQWAVPLRAALDNIAATMDPEVILL
GGGLGCDAARALADLPAVAPWFCPAILPAKLADDAGVIGAGLSIFTADAPSQEKRARGKR
ARGKRAVLVNGVPASGKSRLAKALSDRTGWPILSLDGIKNPFLQHIGPVDRDFNRTLGKA
SYQAIWSIIADAPAGSTFIIDAWFGFQPKAQLENYIDAAKVGDVAELWCKVPGTVAGERY
ASRLKERLPGHPGAEYVPELITLADRAEPMGCGAVMTVEQTKEPDMEVILAWVWQVFDRQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatcgccataggcgtcgatattggcggcacgaatattcgtgcggccctcgtc
tccgttcagggcgagatccttgccaaggtgtcggaaagaaccccgaccgatcccctgttg
gcattggagcgcgtgatcgcgatggcgcgcgcgctcgacactcctgaagttctggggatc
ggtgtcggcatacccgggcgtgtcgatgtcgatagtcgcgagatcctgtctggcggcatt
cttaacctctctggcctcgatttcgtgcggcgaattgaggcggcacttggaaagcctgtc
gtcatcgagaatgattgcagcatggcactgatcgccgaaatgcggatcggcggcgccaaa
ggctatcaaaatgttgcgatgctgacgatcggaacgggcattggcggcgctgtcgcccat
gccgggcgcatttaccacggacacaaggcggcgggacaactcggccatatttgtgtatcg
caggatggcccgccctgcccttgcggcaggcgcggctgtgtcgagaccttcagttcggga
accgctttgcgccgacacatcgccgaagcgggattgtcggtcgtgacaatcaaggaggtg
ttcgacatggctgccgagggagatgatgcggccgtgcgcgtcttgcgccaatgggcagtc
cctttacgagcagcactcgataatatcgcggcgacgatggatcccgaagtcatcctgctt
ggcggcgggctcggctgcgacgcggcgcgtgcgcttgcagacctgccggcggtagcgcca
tggttctgccccgcaatattgccggccaaactcgccgatgacgctggcgtgatcggcgcg
ggcctgtcgattttcactgccgatgcgccgtcacaggaaaagcgggcacggggaaagcgg
gcacggggaaagcgggccgtcctggtcaacggcgtgccggcttccggtaaaagccgcctt
gccaaggctttgtccgatcgaaccggttggccgatcctgtccctcgatggcatcaagaat
ccgttcctgcagcatatcggaccagtcgatcgcgacttcaaccggactttgggaaaagcg
agctaccaggcgatctggtccattattgcggacgctccggccggctcgaccttcatcatc
gacgcctggttcggcttccagccgaaggcgcagctcgaaaactatatcgatgctgcgaaa
gtcggggatgtcgcggagctgtggtgcaaggtgcctggaacggtcgcgggcgagcgttat
gccagccgactgaaggagcggttgcctgggcatccgggcgccgaatatgtgccggaactg
ataacgctggcggatcgggccgagcctatgggctgcggtgcagttatgactgtcgagcag
accaaagagccggacatggaggtaattctggcctgggtttggcaggtattcgaccgccaa
taa

DBGET integrated database retrieval system