KEGG   Rhizobium tropici: RTCIAT899_PC05725Help
Entry
RTCIAT899_PC05725 CDS       T02432                                 

Gene name
celC
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rtr  Rhizobium tropici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RTCIAT899_PC05725 (celC)
Enzymes [BR:rtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RTCIAT899_PC05725 (celC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:1223083..1224132
Genome map
AA seq 349 aa AA seqDB search
MKLWRLVLAICSVAILTTAQPAAAQRAAIDPQAWAAYKAKFLDVNGRIIDNGNGGISHSE
GQGYGMLLAYLANSPADFEQIWYFTRTELLLRDDGLAVWKWDPAVIPHVADTNNASDGDL
LIAYALALAGSAWNNRDYLQTAASMARSILAHLVITSAGTTLLIPGAEGYRPPGRKDGPV
INPSYWVFEAIPVMALLVPSDRWKKLSNDGLALLRSLQFGPRRLPADWVSLKAKPEPADG
FEAEFGYNSVRIPLYLARAGIDDKALLSRLQQGMTVTEDEPATIDLATGKPKDLLPDVGY
RIVNDVVACVVSGTKLPASVRRFTPSLYYPATLQLLSLAFVTEKHPECL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttggcgccttgttcttgctatctgcagcgtggccatattgacgacagcgcaa
ccggctgccgctcaacgagcggcaatcgatccgcaggcctgggctgcctacaaggcgaaa
ttcctcgatgtgaatggtcgcatcatcgacaacggcaatggcggcatcagccatagcgag
gggcaaggatacggcatgctgcttgcttatcttgccaatagtccggccgatttcgaacag
atctggtattttacccgcacggagctgctgctacgcgatgacggtcttgccgtctggaaa
tgggacccggccgtcatcccgcacgtagcggacacgaacaatgcttcggatggcgatctg
ctgattgcttacgcgctagccctggcgggatcggcctggaacaacagagattatctacag
acggccgcaagcatggcgagatccatccttgctcatcttgtcatcacgtccgcagggacg
acgctgcttattccaggcgccgaaggttaccggccaccggggcgcaaggatgggccggtc
atcaatccatcctattgggtcttcgaagcgatccccgtcatggcgctgctggtgccttcc
gatcgctggaagaagctcagcaacgacggccttgccctgctgcgctccctgcaatttggc
ccgcgtagacttcccgccgattgggtcagcctcaaggcgaaaccggaacccgcggacggc
ttcgaagcggaattcggctataatagcgtcaggatcccgctttacttggcgcgcgccggg
atcgacgacaaggcgttgctttcacgcctccagcagggaatgaccgtcacggaggatgag
cctgccacgatcgatctggcgaccggcaagccgaaggacctccttcccgacgtgggttat
agaattgttaacgatgttgtggcgtgtgtggtgagcggtacgaaactgcctgcttcggtc
cggcggttcaccccatcgctttactatccggccaccttgcagctgttgagcctggctttc
gtcacggagaagcatccggagtgtttataa

DBGET integrated database retrieval system