KEGG   Rhizobium tropici: RTCIAT899_PC05725Help
Entry
RTCIAT899_PC05725 CDS       T02432                                 

Gene name
celC
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rtr  Rhizobium tropici
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rtr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:1223083..1224132
Genome map
AA seq 349 aa AA seqDB search
MKLWRLVLAICSVAILTTAQPAAAQRAAIDPQAWAAYKAKFLDVNGRIIDNGNGGISHSE
GQGYGMLLAYLANSPADFEQIWYFTRTELLLRDDGLAVWKWDPAVIPHVADTNNASDGDL
LIAYALALAGSAWNNRDYLQTAASMARSILAHLVITSAGTTLLIPGAEGYRPPGRKDGPV
INPSYWVFEAIPVMALLVPSDRWKKLSNDGLALLRSLQFGPRRLPADWVSLKAKPEPADG
FEAEFGYNSVRIPLYLARAGIDDKALLSRLQQGMTVTEDEPATIDLATGKPKDLLPDVGY
RIVNDVVACVVSGTKLPASVRRFTPSLYYPATLQLLSLAFVTEKHPECL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttggcgccttgttcttgctatctgcagcgtggccatattgacgacagcgcaa
ccggctgccgctcaacgagcggcaatcgatccgcaggcctgggctgcctacaaggcgaaa
ttcctcgatgtgaatggtcgcatcatcgacaacggcaatggcggcatcagccatagcgag
gggcaaggatacggcatgctgcttgcttatcttgccaatagtccggccgatttcgaacag
atctggtattttacccgcacggagctgctgctacgcgatgacggtcttgccgtctggaaa
tgggacccggccgtcatcccgcacgtagcggacacgaacaatgcttcggatggcgatctg
ctgattgcttacgcgctagccctggcgggatcggcctggaacaacagagattatctacag
acggccgcaagcatggcgagatccatccttgctcatcttgtcatcacgtccgcagggacg
acgctgcttattccaggcgccgaaggttaccggccaccggggcgcaaggatgggccggtc
atcaatccatcctattgggtcttcgaagcgatccccgtcatggcgctgctggtgccttcc
gatcgctggaagaagctcagcaacgacggccttgccctgctgcgctccctgcaatttggc
ccgcgtagacttcccgccgattgggtcagcctcaaggcgaaaccggaacccgcggacggc
ttcgaagcggaattcggctataatagcgtcaggatcccgctttacttggcgcgcgccggg
atcgacgacaaggcgttgctttcacgcctccagcagggaatgaccgtcacggaggatgag
cctgccacgatcgatctggcgaccggcaagccgaaggacctccttcccgacgtgggttat
agaattgttaacgatgttgtggcgtgtgtggtgagcggtacgaaactgcctgcttcggtc
cggcggttcaccccatcgctttactatccggccaccttgcagctgttgagcctggctttc
gtcacggagaagcatccggagtgtttataa

DBGET integrated database retrieval system