KEGG   Rhizobium tropici: RTCIAT899_PC06540Help
Entry
RTCIAT899_PC06540 CDS       T02432                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rtr  Rhizobium tropici
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rtr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:complement(1398817..1399863)
Genome map
AA seq 348 aa AA seqDB search
MPEILSLEELRERFSNASGGEMFDPEFQKVAELVFGGGDSRQAPYCGMPTLLKAPYRPDA
SPNFTGIDIALFGIPMDLGVTNRSGARFGPRAVRNVDRVGPYEHVLRAVPTAHARVADVG
DVPFRSRFDLAASHEDIERFVLGVVKAGVVPLAVGGDHSIGLPILRAVGKDRPVGMIHID
AHCDTGGSFEGCKFHHGGPFRQAVLDSVLDPRRTVQIGIRGNSEYLWEFSYASGMTVIHA
EDVGDIGIGAIIARAREIVGSGPTYISFDVDSLDPAFAPGTGTPEVGGLTSAQALGILRG
LAGLNIVGGDVVEVAPQYDPTTNTAQIAAQVLFELLCLTAEAIKIRAS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccggagattctaagcctggaagaattgcgggagcgcttttcgaacgcttcgggcggc
gagatgttcgatccggagtttcaaaaggttgccgagctggtcttcgggggcggcgacagc
cgtcaggctccctattgcggcatgccaacgcttttgaaggctccttatcgtcctgatgcg
tcgcccaattttaccggcatcgacatcgcgcttttcgggataccaatggatcttggcgtg
acgaaccgatcgggcgcgcggttcggtccgcgtgccgttcgaaatgtcgatcgagtcggt
ccttatgagcatgtgttgcgggccgttccaaccgcccatgcacgggtcgccgatgtcggc
gatgttccattcaggagccgttttgatctcgccgcatcccatgaggatatcgagcgattt
gtcctcggggtggtcaaggcgggcgtcgtgcctctggctgtcggcggcgaccattcgatc
ggtcttcccattctcagggctgtcggcaaggatcgaccggtggggatgatccatatcgat
gcgcattgcgataccggtggttccttcgagggctgcaaattccatcatggcggtcccttc
cgtcaggcggttctcgacagtgtgctggatccgcggcggacggttcagatcggcattcgc
ggaaattcggaatatctatgggagttctcgtatgcctccggcatgactgtcatacatgct
gaagacgttggcgatatcggcataggggcgattatcgcgagggcgagagagatcgtcggc
tcgggtccgacctatatcagcttcgatgtcgattctctcgatccggcatttgcgcccggt
acggggacgcctgaagtcggcggactgacctccgcccaggcgctgggcatcctgcgaggt
cttgcgggattgaacatcgttggcggcgacgtcgttgaggtcgctccacagtacgatccg
acaacgaacacggcgcaaatcgcggcgcaggttttattcgaactcctctgcctgacggcg
gaggcaatcaagattcgcgcgtcctag

DBGET integrated database retrieval system