KEGG   Rhizobium tropici: RTCIAT899_PC07085Help
Entry
RTCIAT899_PC07085 CDS       T02432                                 

Gene name
exoN
Definition
succinoglycan biosynthesis UTP--glucose-1-phosphate uridylyltransferase ExoN
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rtr  Rhizobium tropici
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rtr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RTCIAT899_PC07085 (exoN)
   00052 Galactose metabolism
    RTCIAT899_PC07085 (exoN)
   00500 Starch and sucrose metabolism
    RTCIAT899_PC07085 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    RTCIAT899_PC07085 (exoN)
Enzymes [BR:rtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RTCIAT899_PC07085 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRtrCIAT899c:complement(1516207..1517112)
Genome map
AA seq 301 aa AA seqDB search
MDPKRRVRKAVIPVAGNGTRFLPATKAMPKEMLTIVDRPVVQYAVDEAIEAGIEHIVFVT
SRNKSAIEDHFDDTPELISSLQRAGKSQQVSELERLLPRPGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMLCYGMRGCMAGLMDLYNETGGNIVAVEECAPEETSKYGIIGKG
ESVRHGFAVTKMVEKPHPSEAPSNFYLNGRYILQPEIFDILARQERGAGNEIQLTDGMLR
LSETQYFHAQVYNGRTFDCGSKHGFIEANVAFALARADIGGLVYDSIRNLVVSHEAQMTA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaaacgtcgtgtgagaaaagcagtgatcccggttgccggcaacggaacgcgc
ttcctgcccgccaccaaggcgatgccgaaggaaatgctgacgatcgttgatcgtcccgtc
gtccaatatgccgttgacgaagccatcgaggccggcatcgagcacatcgtcttcgtcacc
agccgcaacaagtcggcgatcgaagatcatttcgatgatacgccggagctgatctcctcg
ctgcagcgggccggcaagagccagcaggtcagcgagttggaacgtcttctgccgcgtccg
ggctcggtaagcttcacccggcagcaggcgccgcttggcctcggccacgccgtctggtgt
gctcgtgacctgatcggcgacgagccttttgcgctgcttttgcctgatatgctctgctac
ggtatgcgtggctgcatggccggcctgatggatctctacaacgagaccggcggcaacatc
gtcgccgtcgaggaatgcgccccggaagagacgtcgaaatacggcattatcggcaagggc
gagtccgtgcgccatggctttgccgtgaccaaaatggtcgagaagcctcatccgtccgag
gcgccttcaaacttttacctcaatggccgttatattctgcagcccgaaatcttcgatatt
ctggcccgccaggagcgcggtgccggtaacgagatccagctgaccgacggcatgctgcgc
ctgtccgagacgcaatacttccatgcccaggtctataatgggcgtacgttcgattgcggg
tcgaagcacggcttcatcgaagcgaacgttgccttcgcgctcgctcgcgccgatatcggc
ggtttggtctatgactcgatccgcaacctggtcgtctcgcacgaagcgcagatgaccgcc
gcttaa

DBGET integrated database retrieval system