KEGG   Rickettsia typhi TH1527: RTTH1527_00570Help
Entry
RTTH1527_00570    CDS       T01802                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rtt  Rickettsia typhi TH1527
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RTTH1527_00570
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RTTH1527_00570
   00650 Butanoate metabolism
    RTTH1527_00570
  Energy metabolism
   00190 Oxidative phosphorylation
    RTTH1527_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150470..150847
Genome map
AA seq 125 aa AA seqDB search
MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE
FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA
IFYSE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgattttaaggcagaaattataaaatctaaaagtagcagttcttctaaaagt
ggtgcgcatcattggttattgcaaagagtaactggtgtggtattagctttatgttctttt
tggttaatatattttatgtttaccaacaaaaataatgatataaatattattatgtgggag
tttaaaaaaccttttaatatagtaattttattaattacggttactatttcattgtatcat
tcagtacttgggatgcgtgtagtaattgaggactatataaattgtcacaaattacgtaat
acattgattataatagtgaaattattttgtattttgactattgtagcttttatagtagcg
atattttatagtgaataa

DBGET integrated database retrieval system