KEGG   Rickettsia typhi TH1527: RTTH1527_01190Help
Entry
RTTH1527_01190    CDS       T01802                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rtt  Rickettsia typhi TH1527
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rtt00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rtt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308198..308725)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVRFVANILYKPNLQVLNRGYSIAIQESSVNTNATVIVQ
EPVNIPEVMKTANANHGREIVKKCLMCHSLDKDGPNKLGPHLWNIVGRSKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgattgttagatttgttgcaaatatattatataaaccgaacttacaagtgttaaatcgc
ggttatagcattgcaattcaggaatcatcagtaaacacaaatgctacagtaatcgtgcaa
gaaccggtaaatataccggaagtgatgaaaactgctaacgcaaatcatggtcgtgaaata
gtaaaaaaatgtttaatgtgtcattctcttgacaaagatggtccaaataaactaggacca
catctttggaatatagtaggaagatccaaagcaagcataacagactataaatactccttt
gctatatcaaagcttggaggcgtatgggatgatgaaaatttatttgctttcttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatatcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgataaataa

DBGET integrated database retrieval system