KEGG   Rickettsia typhi TH1527: RTTH1527_02555Help
Entry
RTTH1527_02555    CDS       T01802                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rtt  Rickettsia typhi TH1527
Pathway
rtt00860  Porphyrin and chlorophyll metabolism
rtt01100  Metabolic pathways
rtt01110  Biosynthesis of secondary metabolites
rtt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RTTH1527_02555
Enzymes [BR:rtt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RTTH1527_02555
Exosome [BR:rtt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTTH1527_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD UxuA DUF2097 FUN14
Motif
Other DBs
NCBI-ProteinID: AFE54376
Position
complement(672626..673618)
Genome map
AA seq 330 aa AA seqDB search
MYPIIRFRRNRKALWLRELIAESNLSISDLVLPLFVVEGHNVKQEIKTMPGIYRLSIDQI
VETAKKAADFGINAIALFPSIDHSLKSDNADEAYNLDNLICRTIIEIKNANIDIGIICDV
ALDPYTTSGHDGIVYHGEVDNDISVKALCNQALVLAKAGVDIVAPSDMMDGRIAAIREYL
DKAGFINVGILAYAAKYASSFYGPFRDAVQSNKKNYLDKSSYQIDVRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNAKIFAYQVSGEYAMLKFAAEAGAINWERALIES
LISFKRAGATGIFTYAAFEVAEVLKNNNIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctattattagatttagaagaaatagaaaagctttatggcttagagagttaata
gccgagagtaatttatcgattagcgatttagtgttgcctttatttgttgttgaaggtcat
aatgtaaagcaagaaattaagactatgcctggtatatatcgtttatcaatcgatcagata
gtcgaaactgcaaaaaaagcagcagattttggtattaatgcgattgcattatttcctagt
attgatcatagtctaaaaagtgacaatgcagatgaggcctataatctagataatttaata
tgtagaactattatagaaatcaaaaacgccaatattgatattggtataatatgtgatgtc
gcacttgatccttatactacaagcggtcatgatggtattgtgtatcatggagaagttgat
aatgatatatcagtaaaagctttatgtaatcaagcattagtgttagcaaaagcgggagta
gatatcgttgctccttccgatatgatggatggaagaatagcagctataagggaatatctt
gacaaagcaggatttataaatgttggcattcttgcttatgcagctaaatatgcttcaagc
ttttatggcccatttcgtgatgcagttcagagtaataaaaagaattatttagataaatca
agctatcaaattgatgtgcgtaatattaaggaagcaatgcttgagattgaacatgatata
gcggaaggagcagatattgtaatggttaaaccaggtatgccgtttttggatgtgattcgt
gaagcggcaaataattttaatgctaaaatttttgcatatcaggtgagcggggaatacgca
atgttaaaatttgccgcagaggcaggagcaattaattgggagagagctttaatagaatca
ttaattagttttaaacgtgccggtgcaacaggaatatttacctatgctgcttttgaagta
gctgaagtattaaagaataataacattaagtag

DBGET integrated database retrieval system