KEGG   Rickettsia typhi TH1527: RTTH1527_02640Help
Entry
RTTH1527_02640    CDS       T01802                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rtt  Rickettsia typhi TH1527
Pathway
rtt00071  Fatty acid degradation
rtt00280  Valine, leucine and isoleucine degradation
rtt00281  Geraniol degradation
rtt00310  Lysine degradation
rtt00362  Benzoate degradation
rtt00380  Tryptophan metabolism
rtt00640  Propanoate metabolism
rtt00650  Butanoate metabolism
rtt00903  Limonene and pinene degradation
rtt00930  Caprolactam degradation
rtt01040  Biosynthesis of unsaturated fatty acids
rtt01100  Metabolic pathways
rtt01110  Biosynthesis of secondary metabolites
rtt01120  Microbial metabolism in diverse environments
rtt01130  Biosynthesis of antibiotics
rtt01200  Carbon metabolism
rtt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rtt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RTTH1527_02640
   00650 Butanoate metabolism
    RTTH1527_02640
  Lipid metabolism
   00071 Fatty acid degradation
    RTTH1527_02640
   01040 Biosynthesis of unsaturated fatty acids
    RTTH1527_02640
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTTH1527_02640
   00310 Lysine degradation
    RTTH1527_02640
   00380 Tryptophan metabolism
    RTTH1527_02640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RTTH1527_02640
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RTTH1527_02640
   00281 Geraniol degradation
    RTTH1527_02640
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTTH1527_02640
   00930 Caprolactam degradation
    RTTH1527_02640
Enzymes [BR:rtt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RTTH1527_02640
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RTTH1527_02640
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RTTH1527_02640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 NAD_binding_2 NAD_Gly3P_dh_N UDPG_MGDP_dh_N NAD_binding_8 ApbA Pyr_redox_2 DAO
Motif
Other DBs
NCBI-ProteinID: AFE54393
Position
complement(705867..708029)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHRVVLLDILDKDSNDPNKIVKNAVKNLHRQKL
PPLSYPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLDIKHQLYNKIIPYLKEDTIIAS
NTSTLPLKKLKENLPNNIKSRFIITHFFNPPRYMELVELIIDNTIKDEVIEKISVFLTKI
LGKTIIKCNDTPGFIANRVGCFLLELVAHKAIAQNLDFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLLSALPKSDDYHRIYFNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNNLDELLASDSIYSKFFSEIITEFYIYLTSLVPSVT
NNIYDIDATMKLGYSWHYGPFELLTIAVKNGWNSIIKNADLMNISLPKYLASKEYQKIDK
QKFNSKKDFLQESTIVLANDSANLIHYCENLIFVITTKMNTLNHNVFYLLQEAVSKAENY
GKNLYIFPQGNNFSAGADLKLILSYIQDGNFDNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIEFGVGLIPGWSGVTEMFARSNGDKTKLIRNIK
NIIEQNKTSSADYFKADYDVSNMQVNMNKHYILDEALKLNVSNKIVSIPHKIALPKINIV
SEIDTSKYNDLQNKVLNKFQNIIDKHNEISEAELLTYEREIFLELAKEPQTIEKLHAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagttatggggtcaggaatt
gcagcgttaattgctaattcttctcaccgagtagttttgcttgatattctcgataaagat
tctaatgatcctaataaaatagtaaaaaatgctgtaaagaatttgcatagacaaaaactt
cctccattatcttatccagataaagtaaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttattgttgagaagttagacatc
aaacatcaattatataataaaattataccttatcttaaagaagacacaattattgcttct
aatacctctacattgccactgaaaaaactcaaagagaatttaccgaataatataaagtcc
aggttcattattacgcatttctttaatccaccgagatatatggagttggttgaattaatt
atagacaatacaatcaaggatgaggtaatagagaaaatatcagtgttcttaacaaaaatt
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtaggg
tgttttttacttgagttagtagcccacaaagcgatagctcaaaatcttgattttgttaca
atcgatcaaatatttagtagatgtttaggtttgccaaataccggaatttttggcttatat
gatttaataggtcatgacgtaatgaagttaatatcaagttcattactttctgctctgcct
aaaagtgatgattatcataggatatattttaataccaaagtttttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aaaaagattaaagaagttattaatataagtgatttatcatatcaccctgttcagaaagta
gatatttcatttaataatcttgatgagttgttagctagcgattcaatttatagcaagttt
tttagtgagattatcacagaattttatatttatttaacaagcttagtaccatctgtgact
aataatatctacgatattgatgctactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaattcgataattaaaaatgctgat
ttaatgaatatttcactacctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtacaatagtattagcaaatgat
tctgcaaatttaatacattattgtgaaaatttaatatttgttattactacgaaaatgaat
actttgaatcataatgtgttttatttattgcaagaagcagtaagtaaagcagaaaattat
ggaaaaaatctttatattttcccacaaggaaataatttttctgctggtgcggatttaaag
cttattctttcttatattcaagatgggaattttgataatttagagaatttattaaagctt
ggacaacaaacaatgcgttatttaaaatattcctctgtacatattattagctgtgctcgt
ggtgttgcgcttgggggtgggtgtgaacttctattaaactcaagctatattgttgcaaat
caggagcttaacgccggacttatagagtttggagtaggtttaataccaggatggagtggt
gttacagaaatgtttgctagaagtaatggagataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatgatgta
agtaatatgcaagtcaatatgaacaagcattatattttagatgaagctttgaaactaaac
gtatctaacaaaatagtatcaatacctcataaaattgctttacctaaaattaatatagta
agtgaaatagatacatccaaatataatgatctacaaaataaggtacttaataaattccag
aatattattgataaacataatgaaataagtgaagcagaattacttacatatgagcgtgaa
atatttttagaacttgcaaaagaaccgcagactatagagaaattgcacgcgattgtgggg
taa

DBGET integrated database retrieval system