KEGG   Rickettsia typhi Wilmington: RT0245Help
Entry
RT0245            CDS       T00193                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rty  Rickettsia typhi Wilmington
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RT0245 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RT0245 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308184..308711)
Genome map
AA seq 175 aa AA seqDB search
MTGKELNKIVAAILFASLIAMIVRFVANILYKPNLQVLNRGYSIAIQESSVNTNATVIVQ
EPVNIPEVMKTANANHGREIVKKCLMCHSLDKDGPNKLGPHLWNIVGRSKASITDYKYSF
AISKLGGVWDDENLFAFLHKPSSYAPGTKMSFAGISKPQDIADVILFLKNYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgattgttagatttgttgcaaatatattatataaaccgaacttacaagtgttaaatcgc
ggttatagcattgcaattcaggaatcatcagtaaacacaaatgctacagtaatcgtgcaa
gaaccggtaaatataccggaagtgatgaaaactgctaacgcaaatcatggtcgtgaaata
gtaaaaaaatgtttaatgtgtcattctcttgacaaagatggtccaaataaactaggacca
catctttggaatatagtaggaagatccaaagcaagcataacagactataaatactccttt
gctatatcaaagcttggaggcgtatgggatgatgaaaatttatttgctttcttacacaaa
ccaagtagctatgccccaggaactaaaatgtcctttgcaggtatatcaaaaccacaagac
atagctgatgtaatattatttttaaaaaactatgttcatgataaataa

DBGET integrated database retrieval system