KEGG   Rickettsia typhi Wilmington: RT0264Help
Entry
RT0264            CDS       T00193                                 

Definition
(GenBank) HSP22-like heat shock protein
Organism
rty  Rickettsia typhi Wilmington
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
332686..333177
Genome map
AA seq 163 aa AA seqDB search
MLKYIPAIFAIILSSNIAIASKNYDYINATPLRQVADLIDSHITNIDHLFNNRLMFYESS
SIKSKFITKDKQYVIIMEVPGFDKNQIKVKLNGKKLFIAGNIEEKNKANDSDNYMNKNFN
YVISLYEDVDQTNISARLKNGILTIILPRIEVKEQDAKEITIN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatatattccagctatatttgctattattttatctagtaatattgcaatagct
agtaagaattatgattacattaatgcgacgccgctgcgtcaggtagcagatttgatagat
agtcacattacaaatattgatcatttatttaataatagattaatgttttatgaatctagt
agcataaaaagtaaatttattaccaaagataaacaatatgttattattatggaagtgcca
ggttttgataaaaaccaaattaaggttaaattaaatggcaagaaattatttattgccggg
aatatagaagaaaaaaataaagccaatgattcagataattatatgaataaaaattttaat
tatgtcatatcattatatgaagatgtagatcaaacaaatatctctgcgcgcttaaagaat
ggtatacttactattattttacctcgtattgaagttaaagaacaagatgcaaaagagatc
acgattaattaa

DBGET integrated database retrieval system