KEGG   Rickettsia typhi Wilmington: RT0288Help
Entry
RT0288            CDS       T00193                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rty00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364253..365029
Genome map
AA seq 258 aa AA seqDB search
MNDNLINALKDLIINTGKVALDIKKTGILIDTKSDGSVVTNADQEISKIIYQTLQSLTSQ
IAIVCEEQPLPILNSDTFWLIDPIDGTRSYVDGKNTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSQEIFVKHAPKHKEPNAVVGFYNSNKATKEFLRSYSFGKINTIS
SSIKLCLIAEGEADIYPKFGQTMEWDIAAGHALIKASGGNILDCDGQEVTYGKVNFANPH
FFACSKYWLEMDYIFCIR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaatactggtaaggttgca
ctagatatcaaaaaaacaggaatattgattgatactaaatcagatggttctgtggtcacg
aatgcagatcaggaaattagtaaaataatttatcagactttacaaagcttaacatctcaa
atagcaatagtatgtgaagagcagccactacctatattaaacagtgatactttttggtta
atcgatcctattgatgggacacggagctatgtagatggtaaaaatacatatacggtaaat
ataggcctgattgaaaatggttttccgactatcggtttgatatatcatcctgaaacagca
aagctgtattatactgatgtaaacggtcgattaaaaatcgaacagaattctcaagaaata
tttgtgaagcatgcacctaaacataaagagcctaatgctgtagtaggtttttataattca
aataaagctactaaagaatttttaaggagttattcattcggtaaaataaatacaataagt
agttcaattaaattatgtttaattgctgaaggtgaagctgatatatatcccaaatttggt
caaactatggagtgggatatagctgcaggtcatgcattaattaaagctagcggcggtaat
attttagattgtgacggacaagaagtgacttacggtaaagtaaattttgctaatcctcat
ttttttgcatgtagtaaatattggttggaaatggattatattttttgtatacgctaa

DBGET integrated database retrieval system