KEGG   Rickettsia typhi Wilmington: RT0374Help
Entry
RT0374            CDS       T00193                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rty00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RT0374 (ruvA)
Enzymes [BR:rty01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RT0374 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474407..475009
Genome map
AA seq 200 aa AA seqDB search
MIGKLSGKIDSQCDDYVIIDVNGVGYLVYASGTTLAKLVEGRFYKLFIETHVREEHIHLY
GFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIKIAINNDDKNIFKAISGVGDKLT
ERIMLELKGKIAKIFSSSAIIKDSSNISSVEINEVIKALVNLGFTRFEAQNTVQGIITQN
TKISIDELIKTALKNRNSSF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaagtggtaagattgattcacaatgtgatgattatgtaataatcgac
gtaaacggggtaggttatcttgtgtatgcttcaggtacgaccttagcgaaacttgttgaa
ggcaggttttataaactattcatcgaaacccatgttagagaggaacatatccatctttac
ggttttttaactctagaagagaaaaatttttttaatttgctgcaatctgttaatggtatt
ggtacaaaaatggctttgtctattttatcaaatcttactcctacggatattaaaatcgct
ataaataatgatgataaaaatatatttaaagcaatatctggagttggtgataagcttact
gaacgtataatgttagaactgaaaggtaaaatagcaaaaatattcagcagctctgctatt
attaaagatagttctaatatttcatctgttgaaattaatgaagtaataaaagcattagta
aatttaggattcactcgatttgaagctcaaaacactgttcaaggtataatcacacaaaac
actaaaatctcgattgatgaactaatcaaaacagcattaaaaaatcgtaattctagtttt
taa

DBGET integrated database retrieval system