KEGG   Rickettsia typhi Wilmington: RT0374Help
Entry
RT0374            CDS       T00193                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rty00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RT0374 (ruvA)
Enzymes [BR:rty01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RT0374 (ruvA)
DNA repair and recombination proteins [BR:rty03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RT0374 (ruvA)
    RecFOR pathway proteins
     RT0374 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
474407..475009
Genome map
AA seq 200 aa AA seqDB search
MIGKLSGKIDSQCDDYVIIDVNGVGYLVYASGTTLAKLVEGRFYKLFIETHVREEHIHLY
GFLTLEEKNFFNLLQSVNGIGTKMALSILSNLTPTDIKIAINNDDKNIFKAISGVGDKLT
ERIMLELKGKIAKIFSSSAIIKDSSNISSVEINEVIKALVNLGFTRFEAQNTVQGIITQN
TKISIDELIKTALKNRNSSF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaattaagtggtaagattgattcacaatgtgatgattatgtaataatcgac
gtaaacggggtaggttatcttgtgtatgcttcaggtacgaccttagcgaaacttgttgaa
ggcaggttttataaactattcatcgaaacccatgttagagaggaacatatccatctttac
ggttttttaactctagaagagaaaaatttttttaatttgctgcaatctgttaatggtatt
ggtacaaaaatggctttgtctattttatcaaatcttactcctacggatattaaaatcgct
ataaataatgatgataaaaatatatttaaagcaatatctggagttggtgataagcttact
gaacgtataatgttagaactgaaaggtaaaatagcaaaaatattcagcagctctgctatt
attaaagatagttctaatatttcatctgttgaaattaatgaagtaataaaagcattagta
aatttaggattcactcgatttgaagctcaaaacactgttcaaggtataatcacacaaaac
actaaaatctcgattgatgaactaatcaaaacagcattaaaaaatcgtaattctagtttt
taa

DBGET integrated database retrieval system