KEGG   Rickettsia typhi Wilmington: RT0547Help
Entry
RT0547            CDS       T00193                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RT0547 (fadB)
   01212 Fatty acid metabolism
    RT0547 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RT0547 (fadB)
   00650 Butanoate metabolism
    RT0547 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RT0547 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RT0547 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RT0547 (fadB)
   00310 Lysine degradation
    RT0547 (fadB)
   00380 Tryptophan metabolism
    RT0547 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RT0547 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RT0547 (fadB)
   00281 Geraniol degradation
    RT0547 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RT0547 (fadB)
Enzymes [BR:rty01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RT0547 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RT0547 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RT0547 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(705855..708017)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGAGVMGSGIAALIANSSHRVVLLDILDKDSNDPNKIVKNAVKNLHRQKL
PPLSYPDKVNFITIGNLEHDLDLIKECNLVIEVIVEKLDIKHQLYNKIIPYLKEDTIIAS
NTSTLPLKKLKENLPNNIKSRFIITHFFNPPRYMELVELIIDNTIKDEVIEKISVFLTKI
LGKTIIKCNDTPGFIANRVGCFLLELVAHKAIAQNLDFVTIDQIFSRCLGLPNTGIFGLY
DLIGHDVMKLISSSLLSALPKSDDYHRIYFNTKVFDKMIEHNLIGRKGEGGFYRLSVSNG
KKIKEVINISDLSYHPVQKVDISFNNLDELLASDSIYSKFFSEIITEFYIYLTSLVPSVT
NNIYDIDATMKLGYSWHYGPFELLTIAVKNGWNSIIKNADLMNISLPKYLASKEYQKIDK
QKFNSKKDFLQESTIVLANDSANLIHYCENLIFVITTKMNTLNHNVFYLLQEAVSKAENY
GKNLYIFPQGNNFSAGADLKLILSYIQDGNFDNLENLLKLGQQTMRYLKYSSVHIISCAR
GVALGGGCELLLNSSYIVANQELNAGLIEFGVGLIPGWSGVTEMFARSNGDKTKLIRNIK
NIIEQNKTSSADYFKADYDVSNMQVNMNKHYILDEALKLNVSNKIVSIPHKIALPKINIV
SEIDTSKYNDLQNKVLNKFQNIIDKHNEISEAELLTYEREIFLELAKEPQTIEKLHAIVG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttattggtgcaggagttatggggtcaggaatt
gcagcgttaattgctaattcttctcaccgagtagttttgcttgatattctcgataaagat
tctaatgatcctaataaaatagtaaaaaatgctgtaaagaatttgcatagacaaaaactt
cctccattatcttatccagataaagtaaatttcattacaataggtaatttagaacatgat
ttagatttaattaaagaatgtaatttagtaattgaagttattgttgagaagttagacatc
aaacatcaattatataataaaattataccttatcttaaagaagacacaattattgcttct
aatacctctacattgccactgaaaaaactcaaagagaatttaccgaataatataaagtcc
aggttcattattacgcatttctttaatccaccgagatatatggagttggttgaattaatt
atagacaatacaatcaaggatgaggtaatagagaaaatatcagtgttcttaacaaaaatt
cttggtaaaactataataaaatgtaatgatacacctggttttattgctaatagagtaggg
tgttttttacttgagttagtagcccacaaagcgatagctcaaaatcttgattttgttaca
atcgatcaaatatttagtagatgtttaggtttgccaaataccggaatttttggcttatat
gatttaataggtcatgacgtaatgaagttaatatcaagttcattactttctgctctgcct
aaaagtgatgattatcataggatatattttaataccaaagtttttgataagatgatagag
cataatttaattggacgtaaaggtgagggtggattttatcgtttatctgtatcaaatggt
aaaaagattaaagaagttattaatataagtgatttatcatatcaccctgttcagaaagta
gatatttcatttaataatcttgatgagttgttagctagcgattcaatttatagcaagttt
tttagtgagattatcacagaattttatatttatttaacaagcttagtaccatctgtgact
aataatatctacgatattgatgctactatgaagcttggttatagttggcattatggaccg
tttgagttattgactatagctgttaaaaatggatggaattcgataattaaaaatgctgat
ttaatgaatatttcactacctaaatatttagctagtaaagaatatcaaaaaattgataaa
caaaaatttaattctaaaaaagattttttacaagaaagtacaatagtattagcaaatgat
tctgcaaatttaatacattattgtgaaaatttaatatttgttattactacgaaaatgaat
actttgaatcataatgtgttttatttattgcaagaagcagtaagtaaagcagaaaattat
ggaaaaaatctttatattttcccacaaggaaataatttttctgctggtgcggatttaaag
cttattctttcttatattcaagatgggaattttgataatttagagaatttattaaagctt
ggacaacaaacaatgcgttatttaaaatattcctctgtacatattattagctgtgctcgt
ggtgttgcgcttgggggtgggtgtgaacttctattaaactcaagctatattgttgcaaat
caggagcttaacgccggacttatagagtttggagtaggtttaataccaggatggagtggt
gttacagaaatgtttgctagaagtaatggagataaaactaaattaattagaaatattaag
aatattatagagcaaaataaaacaagttcagctgattattttaaagcagattatgatgta
agtaatatgcaagtcaatatgaacaagcattatattttagatgaagctttgaaactaaac
gtatctaacaaaatagtatcaatacctcataaaattgctttacctaaaattaatatagta
agtgaaatagatacatccaaatataatgatctacaaaataaggtacttaataaattccag
aatattattgataaacataatgaaataagtgaagcagaattacttacatatgagcgtgaa
atatttttagaacttgcaaaagaaccgcagactatagagaaattgcacgcgattgtgggg
taa

DBGET integrated database retrieval system