KEGG   Rickettsia typhi Wilmington: RT0722Help
Entry
RT0722            CDS       T00193                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RT0722 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RT0722 (fadA)
   00640 Propanoate metabolism
    RT0722 (fadA)
   00650 Butanoate metabolism
    RT0722 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    RT0722 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RT0722 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RT0722 (fadA)
   00310 Lysine degradation
    RT0722 (fadA)
   00380 Tryptophan metabolism
    RT0722 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RT0722 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RT0722 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RT0722 (fadA)
Enzymes [BR:rty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RT0722 (fadA)
Exosome [BR:rty04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RT0722 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(921426..922604)
Genome map
AA seq 392 aa AA seqDB search
MTQQVYITHAKRTAFGSFMGSLSTTPAPMLAAHLINNILQDSKIEPALVNEVILGQVITG
GSGQNPARQTLIYAGIPQEVPGYTINKVCGSGLKSIALAANSIMTCDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLIDVFSGVFMGITAENIAKQFNISRQEQDEFAL
SSHKKAAKAQLLGILQDEILPIEVTVKKTTSLFDHDETVRHDTSIEMLSKLRPAFDKNGV
VTAGNASSINDGAACVLLVSEKALKKHNLTPLARIVSCASAGVDPRIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRILIT
LIHNLRRAKAKKGLVTLCIGGGLGMSMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaggtttatataacacatgccaaaaggactgcattcggatcatttatgggt
agtctgagtacaactccagcaccaatgctagctgctcatttaatcaataatatactgcaa
gatagtaaaatcgaacctgctttagtaaatgaggtaatacttgggcaagtaataacaggt
ggtagtggacagaatccagcaagacaaactctgatttatgctggtataccgcaagaagtg
ccaggttatacgattaataaagtatgcggctcaggtcttaaaagtatagcacttgcagca
aattcaattatgacatgtgataatgaaatagttatagcaggtgggcaggaaaatatgtcg
ctcggtatgcacggtagttatatcagagcaggagctaaattcggtgatatcaaaatggtt
gatctcatgcaatatgacggtttaatagatgtattttcaggagtatttatgggtatcact
gccgaaaatatcgcgaagcagtttaatattagccgacaagaacaggacgaatttgcctta
agttctcacaagaaagctgctaaagcacagttattaggaattttacaagatgaaatcttg
cctatagaagtaacagtaaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
catgatacaagcattgaaatgcttagtaaattacgccctgcttttgataaaaatggtgta
gttactgctggtaacgcttcctctattaatgacggtgcagcatgtgtcctgcttgtttca
gaaaaagctttgaaaaaacataatttaacaccattagctcgtattgtttcttgtgcttca
gctggtgttgatccaagaattatgggtactgcacctgtgccggcatctaaaaaagcctta
agtaaagcaggttggagcgttaatgatttagaagttatcgaggttaatgaggcatttgca
gcacaaagcatttatgtaaaccgtgaaatgaaatgggatatagagaaggttaacataaat
ggtggagcaatagcaattggtcatccgattggtgcaagcggtggacgtattcttataact
ttaatacacaacttacgaagagctaaggctaaaaaaggcttagtgactttatgtatcggt
ggtggtcttggtatgtctatgtgtgttgaagcagtttaa

DBGET integrated database retrieval system