KEGG   Rickettsia typhi Wilmington: RT0863Help
Entry
RT0863            CDS       T00193                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rty  Rickettsia typhi Wilmington
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rty00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RT0863 (holC)
   00240 Pyrimidine metabolism
    RT0863 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RT0863 (holC)
   03430 Mismatch repair
    RT0863 (holC)
   03440 Homologous recombination
    RT0863 (holC)
Enzymes [BR:rty01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RT0863 (holC)
DNA replication proteins [BR:rty03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RT0863 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1097315..1097779)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYHTSDELLLKAILCLLEKCYYSDLKSVILTTDVDQQEMLNKNLWTYSRKQFIPH
GSKFDPQPTKQPIYITDELQNPNNASVLIIISPTDIEKILQVKEYIRVFKRIIIITDLPE
DLKQLIIKINKFTGQENKIDCFTQNPMGAWNKIA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcatacaagcgatgaattgcttctaaaagcaatattgtgt
cttttagaaaaatgttattactctgatcttaaaagtgtgatattaactacagatgtagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaaacaatttatacctcat
ggtagtaaatttgatccgcagcctacaaaacaacctatttatattacagatgagttacaa
aatcctaataatgctagtgtgcttatcattatttcacctacagatatagaaaaaatttta
caagtcaaagaatatataagagttttcaaaaggataattataatcacagatttacctgaa
gatttaaaacaattaataattaaaataaataaatttactgggcaagaaaacaaaatagat
tgttttactcaaaatcctatgggagcttggaataaaatagcataa

DBGET integrated database retrieval system