KEGG   Ruminococcus sp. SR1/5: CK1_00370Help
Entry
CK1_00370         CDS       T02601                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rum00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CK1_00370
Enzymes [BR:rum01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CK1_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19013..20557
Genome map
AA seq 514 aa AA seqDB search
MRASGILLPVSSLPSKYGIGCFSEEAYEFVDQLARAGQKYWQILPLGPTGYGDSPYQSFS
TFAGNPYFIDLEAFVKEGYLDKSDCEDCDWGTNESYVDYEKIYNSRFRLLRKAFENYDCE
TDQEYRKFVKENAAWLEDYSLYMAIKDSLNGISWIEWPTELKNREKAALAEKREKLAKEV
GFYCFQQFCFFKQWTALKAYANAKGVEMIGDIPIYVAFDSADAWAQPELFQFDKENIPIG
VAGCPPDAFSATGQLWGNPLYDWEYHKKTGYAWWTRRMANCMKLYDVVRIDHFRGFDEYY
SIPYGDKTAEFGHWEKGPGMDLFRALEKNLGKLDVIAEDLGLLTDSVIEMVEESGFPGMK
VLQFAFDENEDSPYLTHRYERNCIVYTGTHDNETTRGWFRNLSQHDRNFARAYIGCEGKH
ETAAVWSMIRAAMSSVADRCVIPVQDYLCLGNEARINEPSTLGDNWKWRMKKGQLNETII
QKIYKMTKLYGRLVKEETEEKEKTEADREKISDK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaagtgggattttacttccggtatccagtctgccatcgaaatatgggatcgga
tgcttttctgaggaagcatatgagtttgtagaccagctggcaagagcaggacagaaatac
tggcagatccttcctctcggacctaccggatatggagattcaccataccagtctttttct
acctttgcgggaaatccgtattttattgatctggaggcttttgtaaaagagggatatctg
gataaaagtgattgcgaggactgtgactggggtacaaacgagagctatgtggattatgag
aagatttataattccagatttcggcttttgagaaaagcctttgaaaattatgactgtgag
acagatcaggagtaccgtaagtttgtaaaagaaaatgctgcctggctggaagattacagc
ctgtatatggcaatcaaggacagcctgaatgggatcagctggatcgaatggcctacggaa
ctcaaaaacagagaaaaagctgcattggctgaaaaaagggagaagcttgcaaaagaagtg
ggattttactgtttccagcagttctgcttttttaaacagtggacagcattgaaagcttat
gcaaatgctaagggagtggagatgatcggagacatcccgatctacgttgcgtttgacagt
gcggatgcctgggcacagccggaattgttccagtttgataaggaaaatattccgatcggc
gttgccggatgcccgccggatgctttttccgccacagggcagctctggggaaatccgctt
tatgactgggaatatcacaagaaaacgggctatgcatggtggacacgccgaatggcaaat
tgtatgaagctttatgatgtggtaaggatcgaccatttcagaggctttgatgagtattat
tccattccgtacggagataaaactgcggagttcggtcactgggaaaagggaccgggaatg
gatctgttccgtgcgcttgaaaagaatcttggaaagctggatgtgatcgcagaggatctt
ggtctccttacagacagtgtgatcgagatggtggaagaatccggattcccgggaatgaag
gtattgcagtttgcttttgacgagaatgaggacagtccgtatctgacgcacagatatgaa
aggaattgcattgtttacacaggtactcatgacaatgagacaacaagaggatggttccgc
aatctgagccagcatgatcgaaattttgccagggcctatattggctgtgagggcaagcat
gagactgcggcagtgtggagcatgatacgtgcggcgatgtccagtgttgcagatcgctgt
gtgatcccggtacaggattatctctgccttggaaatgaggcaaggatcaatgaaccgtca
actcttggtgacaactggaagtggcgtatgaaaaaaggccagctcaatgaaacaattatt
cagaagatttataaaatgacaaagctttatggaagacttgtaaaagaagaaacggaagag
aaggaaaaaacagaagctgacagggaaaagatatctgacaaatag

DBGET integrated database retrieval system