KEGG   Ruminococcus sp. SR1/5: CK1_00370Help
Entry
CK1_00370         CDS       T02601                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rum00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19013..20557
Genome map
AA seq 514 aa AA seqDB search
MRASGILLPVSSLPSKYGIGCFSEEAYEFVDQLARAGQKYWQILPLGPTGYGDSPYQSFS
TFAGNPYFIDLEAFVKEGYLDKSDCEDCDWGTNESYVDYEKIYNSRFRLLRKAFENYDCE
TDQEYRKFVKENAAWLEDYSLYMAIKDSLNGISWIEWPTELKNREKAALAEKREKLAKEV
GFYCFQQFCFFKQWTALKAYANAKGVEMIGDIPIYVAFDSADAWAQPELFQFDKENIPIG
VAGCPPDAFSATGQLWGNPLYDWEYHKKTGYAWWTRRMANCMKLYDVVRIDHFRGFDEYY
SIPYGDKTAEFGHWEKGPGMDLFRALEKNLGKLDVIAEDLGLLTDSVIEMVEESGFPGMK
VLQFAFDENEDSPYLTHRYERNCIVYTGTHDNETTRGWFRNLSQHDRNFARAYIGCEGKH
ETAAVWSMIRAAMSSVADRCVIPVQDYLCLGNEARINEPSTLGDNWKWRMKKGQLNETII
QKIYKMTKLYGRLVKEETEEKEKTEADREKISDK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaagtgggattttacttccggtatccagtctgccatcgaaatatgggatcgga
tgcttttctgaggaagcatatgagtttgtagaccagctggcaagagcaggacagaaatac
tggcagatccttcctctcggacctaccggatatggagattcaccataccagtctttttct
acctttgcgggaaatccgtattttattgatctggaggcttttgtaaaagagggatatctg
gataaaagtgattgcgaggactgtgactggggtacaaacgagagctatgtggattatgag
aagatttataattccagatttcggcttttgagaaaagcctttgaaaattatgactgtgag
acagatcaggagtaccgtaagtttgtaaaagaaaatgctgcctggctggaagattacagc
ctgtatatggcaatcaaggacagcctgaatgggatcagctggatcgaatggcctacggaa
ctcaaaaacagagaaaaagctgcattggctgaaaaaagggagaagcttgcaaaagaagtg
ggattttactgtttccagcagttctgcttttttaaacagtggacagcattgaaagcttat
gcaaatgctaagggagtggagatgatcggagacatcccgatctacgttgcgtttgacagt
gcggatgcctgggcacagccggaattgttccagtttgataaggaaaatattccgatcggc
gttgccggatgcccgccggatgctttttccgccacagggcagctctggggaaatccgctt
tatgactgggaatatcacaagaaaacgggctatgcatggtggacacgccgaatggcaaat
tgtatgaagctttatgatgtggtaaggatcgaccatttcagaggctttgatgagtattat
tccattccgtacggagataaaactgcggagttcggtcactgggaaaagggaccgggaatg
gatctgttccgtgcgcttgaaaagaatcttggaaagctggatgtgatcgcagaggatctt
ggtctccttacagacagtgtgatcgagatggtggaagaatccggattcccgggaatgaag
gtattgcagtttgcttttgacgagaatgaggacagtccgtatctgacgcacagatatgaa
aggaattgcattgtttacacaggtactcatgacaatgagacaacaagaggatggttccgc
aatctgagccagcatgatcgaaattttgccagggcctatattggctgtgagggcaagcat
gagactgcggcagtgtggagcatgatacgtgcggcgatgtccagtgttgcagatcgctgt
gtgatcccggtacaggattatctctgccttggaaatgaggcaaggatcaatgaaccgtca
actcttggtgacaactggaagtggcgtatgaaaaaaggccagctcaatgaaacaattatt
cagaagatttataaaatgacaaagctttatggaagacttgtaaaagaagaaacggaagag
aaggaaaaaacagaagctgacagggaaaagatatctgacaaatag

DBGET integrated database retrieval system