KEGG   Ruminococcus sp. SR1/5: CK1_01550Help
Entry
CK1_01550         CDS       T02601                                 

Definition
Aspartate/tyrosine/aromatic aminotransferase (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rum00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CK1_01550
   01230 Biosynthesis of amino acids
    CK1_01550
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CK1_01550
   00290 Valine, leucine and isoleucine biosynthesis
    CK1_01550
Enzymes [BR:rum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CK1_01550
    2.6.1.66  valine---pyruvate transaminase
     CK1_01550
Amino acid related enzymes [BR:rum01007]
 Aminotransferase (transaminase)
  Class I
   CK1_01550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134067..135284
Genome map
AA seq 405 aa AA seqDB search
MRTFGKSSKLDNVLYDVRGPVVDEAARMEEDGMEILKLNIGNPYPFGFSAPQEVILDMLS
NVRTSQGYSDSKGIFSARKAIMQYAQLRGIPGVTINDIYTGNGVSELINLCMQALLDNGD
EILIPAPDYPLWTATATLAGGNVVHYICDEQSDWYPDIEDIKSKITPRTKAIVIINPNNP
TGAVYPKEILEQIADIARENELIIFSDEIYDRLVMDGYKHTSIASLAPDVFCVTFSGLSK
SHMIAGFRIGWMILSGAKSKAKGYIEGINMLSSMRLCSNVPAQSIVQTALGGYQSVNEYT
QPGGRVYEQRDFIYKALNDIPGISVVKPHAAFYIFPKIDTEKFNIFNDEQFALDFLHEKQ
VLVVPGKGFNWNQPDHFRIVYLPDIRQLDKAMKKMKEFFATYKQG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattcgggaaatcatcaaagcttgacaacgtgctgtacgatgtgcgcggaccg
gttgtggatgaggctgccagaatggaagaagatggaatggagattctgaagctgaatatt
ggtaatccgtatccatttgggttttcagcacctcaggaagtgatcctggatatgctgagt
aatgttcgtacttcccagggatattccgattccaagggcattttttctgcaagaaaagcg
atcatgcagtatgcacagcttcgcgggatcccgggagttaccattaatgatatttatacg
ggaaatggtgtcagtgaactgatcaacctctgtatgcaggcgctgcttgataacggggat
gagatcctgatcccggctccggattatccgctgtggacagctactgcaacactggcaggc
ggaaatgtagttcattatatctgtgacgaacagtctgactggtatccggatattgaggat
atcaagagcaagatcacaccaaggaccaaggcgatcgttatcatcaatcccaataaccct
acaggtgcagtatatccgaaggagatcctggaacagattgcagacattgcaagagaaaat
gagctgatcatcttttctgatgagatctatgaccgtcttgttatggatggatataaacat
acatcgattgcatcccttgcacccgatgtgttctgtgtaacattttcaggattgtccaag
tctcatatgatcgcaggtttccgcatcggatggatgattttaagtggtgcaaaaagtaag
gcgaagggttatatagagggaatcaatatgctctcttccatgcgtctctgttcaaatgtt
ccggcacagtccattgtacagactgcacttggcggatatcagagtgtcaatgaatatacg
cagccgggcggacgtgtttatgagcagagagactttatttacaaggcactgaatgatatt
ccgggaatttccgttgtaaaaccacatgcggcattttatatattcccgaagatcgatact
gagaaattcaatattttcaatgatgaacagtttgctttggattttcttcatgagaaacag
gtgcttgttgttccgggcaagggattcaactggaaccagccggatcacttccgtattgtt
tatctgccggatatccgccagcttgacaaggcaatgaagaagatgaaagagttctttgct
acatataagcagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system