KEGG   Ruminococcus sp. SR1/5: CK1_07910Help
Entry
CK1_07910         CDS       T02601                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rum01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rum00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677402..678712
Genome map
AA seq 436 aa AA seqDB search
MRKVKLTKESTKDILETLLKRSPNNYGKYEDAVANILAKVKAEGDTALFAFTREFDKVEV
TKDTIRVTPEEIEEAYKLVDPSLIDVIKKALVNIRSYHEKQLQNSWFTSTTDGTMLGQKV
TALNCVGVYVPGGKAVYPSSVLMNIVPAKVAGVDRIVMTTPPGKDGKVNPSTLVAANEAG
ADEIYKVGGAQAIGALAYGTESIPKVDKIVGPGNIFVALAKKAVYGYVSIDSIAGPSEIL
VLADETANPRYIAADLLSQAEHDEMASAILITTNEEFADQVDKEVRGFVEVLSRKAIIEK
SLENFGYILIAEDMDEAIEAANEIASEHMEIVTKNPFEDMMKVRNAGAIFIGEHSSEPLG
DYFAGPNHVLPTNGTAKFFSALSVDDFIKKSSIVYYSREALRKIHKDIIQFATSEQLTAH
ANSIAVRFEEEDKENE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaggtaaaactcaccaaagaatctacaaaagatattctggaaactctcttaaaa
agaagccctaataattacggaaaatacgaggatgcagtagcaaatatccttgccaaagta
aaagcagagggagataccgcgttatttgcatttaccagagaatttgataaagtcgaagtg
acaaaggatacgatccgtgtaacccctgaggagatcgaggaagcatacaagctggtagat
ccttccctgatcgatgtgatcaaaaaagcattggtgaatatccgcagctatcacgaaaag
cagcttcagaacagctggttcacaagcacaacagacggaaccatgcttggtcagaaggta
accgctctgaactgtgtaggtgtttacgttcccggtggaaaggctgtatatccgtcttcc
gtgctgatgaatatcgttcctgcaaaagttgccggtgttgaccgtattgtaatgacaaca
cctcctggaaaagacggaaaagtaaatccaagcacacttgttgctgctaacgaagccgga
gcagatgaaatctataaagtgggtggtgcacaggccatcggagcacttgcatatggaacc
gagagtattccaaaggttgacaagatcgtaggacccggaaatatttttgttgcgcttgca
aaaaaggcagtttatggatacgtaagcattgattctattgccggcccaagcgagatcctc
gttcttgcagatgagactgcaaatcctcgttatattgcagcagatcttctttctcaggca
gaacatgatgagatggcatctgcgatcctgatcacaacaaatgaggaatttgcagatcag
gtagataaagaagtcagaggttttgttgaggtactttccagaaaagccattattgagaaa
tccctggagaactttggttatatcctgatcgcagaagatatggacgaggccattgaggct
gccaatgaaattgcttctgaacatatggagatcgtcacaaagaatccttttgaagatatg
atgaaggtacgaaatgcaggtgcgatctttatcggagagcacagctctgaaccccttggc
gattatttcgcaggaccaaaccatgtgcttcctaccaatggaactgccaaatttttctcc
gcactttctgtagatgattttatcaaaaaatccagtattgtatattattccagggaagca
ctccgaaaaatccacaaggacattatccagtttgccacatcggaacagctgactgcacac
gcaaattccattgcagtccgttttgaggaagaggacaaggagaacgaataa

DBGET integrated database retrieval system