KEGG   Ruminococcus sp. SR1/5: CK1_12310Help
Entry
CK1_12310         CDS       T02601                                 

Definition
uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rum00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CK1_12310
Enzymes [BR:rum01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CK1_12310
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CK1_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040423..1041928)
Genome map
AA seq 501 aa AA seqDB search
MKTGKVWLVGAGPGDIGLFTLKGLKVLEQADVVVYDSLVGQGVLSRIPENARLINVGKRA
SHHIMRQENINQVLLEEAQRGLRVVRLKGGDPFLFGRGGEELELLRENGIPYEVVPGVTS
SIAVPAYNGVPVTHRDFCSSVHIITGHKRAGEEYDIDFRALVDTKGTLVFLMGVSALPDI
CEGLIGAGMEKDMPAAILQKGTTAGQKRIVATVSTLEEEVKRQGIETPAIIVVGKVCTLA
EKFGWYEELPLSGWKVLVTRPKELVSRTADMLREKGAEVLELPAIRTVPMEDQSRLYKAL
DHLEEYQWLVFTSPTGVRVFFEELIRHGKDIRAMGNARLAVIGEGTKKALKERGLLADFV
PSVYDGDTLGKELSELLSGGEKILIPRAEKGNEKLTAFLAQAGAVVEDVPTYQTLYEKSQ
LIDEKKEFETGQISCAVFTSASTVKGFVEGTKGLDYSKVKAACIGRQTKAAAESFGMKAY
MSEKATIDSLVKLVVDMKRSE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggaaaagtatggctggtaggagcgggtcctggcgatatcggcctttttaca
ttaaaaggcctcaaagtgctggaacaggcagatgtggtcgtctatgacagtctggtaggt
cagggagttctgtcaagaatcccggaaaatgccaggctgatcaatgtaggcaaacgtgcc
agtcaccatatcatgcgtcaggaaaatatcaatcaggtacttcttgaggaggcacagcgg
ggtcttcgtgtggtgcgcctgaaaggcggagatccattcctctttggaagaggaggagag
gagctggagcttcttcgggagaatgggatcccttatgaggttgttccgggtgttacttcc
tccattgcagtaccggcatataacggggttccggtaacacacagggatttctgttcttca
gtccacatcattacaggacataagagggccggagaagaatatgatatagacttccgggca
cttgttgatacaaagggaacgcttgtatttctgatgggcgtgtccgcacttccggatatc
tgcgagggtctgataggtgcaggaatggaaaaggacatgcctgcggcgatcctgcagaag
ggaactacagcaggtcagaaacggatcgtagcaacagtttctaccctggaagaagaggtg
aaacgccaggggattgagacaccggcgatcattgtggtgggtaaggtatgtacactggca
gagaagtttggctggtatgaagaactgccgctttcaggatggaaggtccttgtcacaaga
ccgaaggagcttgtttccagaactgcggacatgcttcgtgaaaaaggcgcggaggttctg
gagcttccggcgatccgtactgtccccatggaagaccagagccgtctctataaagcgctg
gatcacctggaggaatatcagtggcttgtatttaccagccctacaggtgtaagggtattt
tttgaagaactgatccgccatggaaaagatatccgtgccatgggaaatgcccgtctggcc
gtgatcggggaaggaacaaaaaaggccctgaaggaaagaggtctgctggcagattttgtg
ccgtcggtatatgacggggatactcttggaaaggaactttcagagcttctttccggtgga
gaaaagatacttatcccgcgggcagaaaagggtaatgaaaagctcaccgcatttcttgca
caggcaggcgctgtggtcgaggatgttccgacttatcagactctttacgaaaagagccag
ctcatcgatgagaagaaggaatttgaaacaggacagatcagctgtgcggtgtttacaagt
gcctccactgtgaagggatttgtagagggaacaaaaggactggattattcaaaggttaag
gcggcctgcatcggcagacagacgaaggcggctgctgagagctttggaatgaaagcatat
atgtcagaaaaagccaccattgacagtcttgtcaagctggtggtggatatgaaaaggagc
gaatga

DBGET integrated database retrieval system