KEGG   Ruminococcus sp. SR1/5: CK1_15360Help
Entry
CK1_15360         CDS       T02601                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rum00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CK1_15360
  Lipid metabolism
   00561 Glycerolipid metabolism
    CK1_15360
   00600 Sphingolipid metabolism
    CK1_15360
Enzymes [BR:rum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CK1_15360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296203..1297888
Genome map
AA seq 561 aa AA seqDB search
MSMQVKQNVNEKVQEERMMQKKYADFKLGVPDYVTVETEEERLVCQGGQTTVAAGATTVE
FQDAGEHEDIFVTSEDAVRCVKLRWNYKIPKSARFLGDAWERTYGDAEWHGMSGNRYLPW
YFLAKLSEKVLCFGVKVRPSAMCCWQVDTKGITLFLDVRCGNTGVQLKGRKLCAAQIVCM
EAEGADTFETAQKFCEKMCTDPIFPEFPVYGSNNWYYAYGDSSEEEILSDTDYILKLTEG
VKNPPFMVIDDCWQEHHRLDEYNGGPWTKGNARFPDMKGLADKLEKKGVRPGIWVRLLLN
EDENIPDEWRISYNDCLDPSHPDALEYIRKDIERICDWGYTLIKHDFSTFDLFGKWGFEA
NLRDNSMEKWHFYDQTKTSAEIVKMLYQEIYDASRSNNAVIIGCNTIGHLGAGLMHLNRT
GDDTSGRIWERTRRMGVNTLAFRLPQHNTFYHIDADCVGIFGMIPWEKNRQWADVLAKSG
TPLFVSAKPGVLNPEEFEELHQIMLRASEQEEHFVPLDWEEIDCPEVWGENGETITYDWF
DNEGPTMDATVEYYNAKVVVP
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcaggtaaagcaaaatgtaaatgaaaaagtacaggaggagagaatgatgcag
aaaaaatatgcagattttaagcttggggtaccggattatgtaacagtggaaacagaagag
gagagacttgtgtgccagggagggcagacgacagtagctgccggtgcaactactgtggaa
tttcaggacgcaggtgaacatgaggatatatttgtcacatccgaggatgcagtgagatgt
gtgaagctgagatggaactataagatcccgaaatcagccagatttctgggagatgcctgg
gaacgtacctatggtgatgcggaatggcatggaatgagcggaaaccgttatctgccatgg
tattttctggcgaagctttctgagaaggttctctgctttggcgtaaaggtccgtccttct
gctatgtgctgctggcaggtggataccaaaggaattactttgtttctggatgttcgctgc
ggaaatacaggagtacagctgaaaggaagaaagctgtgtgccgcacagatcgtctgcatg
gaagcagaaggagcagatacttttgaaactgcacagaaattctgtgaaaaaatgtgtaca
gatccgatcttcccagagtttccggtatatggaagcaataactggtattatgcttacggt
gacagctccgaagaggagatcttaagtgataccgattatatcctgaaactgaccgaaggt
gtaaaaaatcctccgttcatggtcattgatgactgctggcaggagcatcaccgcctggat
gaatacaacggtggaccctggacaaaaggcaatgccagatttccggatatgaaaggtctt
gcagacaagctggagaaaaaaggtgtccgcccgggtatctgggtccgtctgcttcttaat
gaagatgagaatatcccggatgagtggagaatttcctataatgactgtctcgatccgtcc
cacccggatgcactggaatatatccgtaaagatatcgagagaatctgtgattggggatac
acgctgatcaagcatgatttttctacctttgatctctttggaaaatggggatttgaggcg
aatttaagagacaattccatggagaaatggcatttttatgatcagaccaaaaccagcgca
gaaatcgtaaaaatgctttatcaggagatttatgatgcttcccggagcaacaacgcagtg
atcatcggctgcaataccatcggacatctcggcgcaggcctgatgcatctgaatcggacc
ggtgacgataccagcggacgtatctgggagcgtaccagacgaatgggcgtaaatacgctg
gcattccgtcttccgcagcacaatacgttttaccatattgatgcagactgtgtcggtatt
ttcggaatgatcccatgggagaaaaatcgtcagtgggcagacgttcttgcaaagagcggt
acaccactgtttgtatccgcaaaacctggagttttgaatccggaggaatttgaggagctg
catcagatcatgctgcgtgcatcagaacaggaagagcattttgttccgcttgactgggaa
gaaatcgactgcccggaggtatggggagaaaacggcgaaactatcacttatgactggttt
gacaacgaaggtccgaccatggatgctacggtggaatactataatgccaaggtagttgtt
ccgtaa

DBGET integrated database retrieval system