KEGG   Ruminococcus sp. SR1/5: CK1_35850Help
Entry
CK1_35850         CDS       T02601                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rum00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3148160..3150433)
Genome map
AA seq 757 aa AA seqDB search
MADKAYEYMDWPRIEAIVYGEEASPRDVMQPRVTEDGVLIQGFFPGADAAEVVVGEKSYP
MILEDEAGYYAVMLPLKRIPEYRFRVIRGSRKETFYDAYECPCQITEEEERAFCAGVYYK
AYEKLGAHPGTCGEVEGTYFAVWAPNAIRVSVVGDFDRWDGRRLPMHRMPMSGIFEIFVP
GVQAGASYQYEIKIKGGNVQRKSDPYGNGTQGAPSVISVVTELGEFLWQDEAWMKERERF
ASREVPVSIYETDVTEWKNSGELVEFLKETGYTHVEFHPVMEYLDRSSGGYSTSVYYAVT
TRFGTAADFRTLVEDLHQAGIGVILDWTPAQFPRFDAGLEKFDGTPLYEVQDPAMAVHPM
WGTMLYNYGSPMVKDFLISNAFFWLDEFHVDGFRMDDVDAMLYLDFGREAGQWTANLYSS
NENLQAMEFLKHLNSIVKKQYPGILLIAQEDGLWPQLTDSVENDHLGFDYKWSGGWTKDL
LSYLEAEPLDRRNYYDQLTLSMMYAYSEHYVLTLGKRDVGTLKEFQEKLPGSSRQKDAQL
RAAYGYLMLHPGVKMTAPDGDVGPEMRAYLHDLNELYRNHPALYAMDGNSDGFEWIQFTS
YDENVVAFLRKTEKPEETILAVCNFSPVSYDSYRVGVPFAGKYKEIFNSDSEKFGGQGVV
NARAKAAIHMECDNREFSLKLKLPAYGVAVFGCTPEKGDVKKNSVKKGNVKKTVGKSRGK
RMDKAKMKVVEKSVAVKDAVKVVKRVASRRKGASGDE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaagcgtatgaatatatggattggccccggatcgaggcgatcgtttatggg
gaggaggcatcacctcgtgatgtgatgcagccaagggtaacagaggatggcgttctgatc
cagggattttttccgggagcggatgctgcagaggttgttgtaggggaaaagagttatccg
atgatcctggaagatgaggctggttattatgctgtaatgcttccactgaaaaggattccg
gaatatcgtttccgtgtgataagaggaagcaggaaagagactttttacgatgcgtatgaa
tgtccatgccagatcacggaagaggaggaacgagctttttgtgccggtgtctattacaag
gcatatgagaagctgggagcgcatccggggacctgtggcgaggtagaaggaacatatttt
gctgtctgggcacccaatgcaatccgtgtcagtgtggtcggtgattttgacaggtgggat
ggaaggcgtcttccgatgcatcggatgccaatgtccggaatttttgagatttttgttcca
ggtgtacaggcaggggcctcttaccagtatgagatcaagatcaaaggcggcaatgtacag
cggaagtctgatccttacggaaatggaacccagggagcgccgtctgtgatttctgttgta
acagagctgggggagtttttatggcaggatgaagcgtggatgaaggaacgtgaaaggttt
gccagccgtgaagttccggtttctatttatgaaacggatgtaacagagtggaaaaacagt
ggtgaattggtggagtttctgaaggaaaccggttatacgcatgtagaatttcatccggtg
atggagtatcttgaccgaagttcaggaggatattctacgtctgtgtattatgctgtgact
acccgttttgggactgcggcagatttccggacactggtagaggatcttcatcaggcaggg
attggcgtgatcctggactggacaccggctcagtttccgcggtttgatgcagggcttgag
aaatttgacggaactcctctttatgaagtacaggatccggctatggccgttcatccgatg
tggggcaccatgctttataattacggaagtcctatggtcaaagatttccttatttccaat
gcgtttttctggctggatgaatttcatgtggacggatttcggatggatgatgtagatgcg
atgctgtatctggattttggaagagaggcgggccagtggacggctaatctttatagttcc
aatgagaaccttcaggcaatggagtttctgaagcatctgaattctattgtgaagaagcag
tatccggggattcttctgatcgcacaggaggatggtttatggccgcagcttacagacagt
gtggagaatgatcatctggggtttgactataaatggagtggtggctggacaaaggatctt
ctttcttacctggaagcagagcctttggacagacgaaattattatgatcagctgacgctt
tccatgatgtatgcatatagtgagcattatgtactgactctggggaagagagatgtgggt
acgttaaaagagtttcaggagaagcttccgggatcttcaaggcagaaggatgctcagctg
cgtgctgcgtatggctatctgatgcttcatccgggtgtgaagatgactgcgccggatggg
gatgtggggccggaaatgagggcgtatctgcatgatctgaatgaactttacaggaatcat
ccggcgttgtatgcaatggatggtaattcggatgggtttgagtggatccagtttaccagc
tatgatgagaatgtggttgcgtttcttcgtaagacggaaaagccggaagaaacgattctt
gcggtgtgtaatttttcaccggtatcttatgacagttaccgggttggtgtgccttttgcg
gggaaatataaggaaattttcaacagtgacagtgaaaagtttggcggacagggtgtggtg
aacgcacgggcgaaagcggctattcatatggagtgtgataacagggaattttctttgaag
ctgaagcttccggcttatggtgtggcggtatttgggtgtacaccggagaagggggatgtg
aagaaaaactctgtgaagaaaggaaatgtgaaaaagactgtggggaaaagcagggggaag
cgtatggataaggcgaaaatgaaggtggttgaaaaatctgtggctgtaaaggatgcggta
aaggttgtgaaacgggtggcttctcgcaggaagggggcttccggggatgagtga

DBGET integrated database retrieval system