KEGG   Ruminococcus sp. SR1/5: CK1_38730Help
Entry
CK1_38730         CDS       T02601                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rum  Ruminococcus sp. SR1/5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rum00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rum00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:rum00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3409174..3411090)
Genome map
AA seq 638 aa AA seqDB search
MHAYKNNINQSSVDFVYENHELKAQAGGKELEIVMISPEKLKAVYHMRLFDGVPAVQTWT
EIINEGSEDQGLTYVSSFMYQGISRGGEKPYYKKTDIYVPFNSWCCEAQWQKYDAETLNL
NGMVVDGFNHQGYGLNRYCYSGKGTWSTCEYLPMGIAEDRETGETYIFQIESSGQWLAEY
GSAQGGNLYLALSGATEQEHGWYKNLKPGESFTTVPAGAAVVKGGLNPAAAALTRYRRKV
RRPNTDDEKLNVVFNDYMNCLMGDPTTERELSIIDKAAELGCEYYCLDAGWYDDGFWWDR
VGEWKEASGRFPNGLKEVCDHAHSKGLKMGLWLEIEVMGVACELANKLPDDWFVCRHGKR
HIDNKRYMLDFRNPEVRKYCRDVVDRLINDYGVEYFKVDYNVTMGYGSDLNSDSCADAIR
EHYECLHQWYEEIFRDHPELVVENCGSGGQRMDYGMLKILSLQSTSDQTDYLYNANIAAN
VASAVTPEQGGMWVYPYEDEEEHVIYNVVNGMLLRPYISGMVWKLGENSMNRMKEGISLY
KEIREEVRDGVPFFPLGFGTLKSEVLAYGVKAEKNTYLSVWTPGTTEAVIPLENAEQVRR
VSVIYPKEEMCGYKIENGNLVVKMPQEKAARLFKIEMK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctacaaaaacaacatcaatcagtcctctgtggattttgtttatgagaaccat
gagctgaaggcacaggccggcggaaaagagctagagatcgtaatgatttccccggaaaag
ctgaaggcagtatatcatatgcgcctgtttgatggagtgccggcagtacagacttggaca
gagatcatcaacgagggaagcgaggatcaggggctgacctatgtttcttcttttatgtat
cagggaatttccagaggcggcgagaagccttattataaaaaaacagatatctatgtgccg
tttaacagctggtgctgtgaggcacagtggcagaaatacgatgcagaaacgctgaattta
aacggaatggtcgtagatggcttcaatcatcagggatatggcctgaaccgttattgttac
agtggaaagggcacctggtctacctgtgagtatcttcccatgggaattgccgaggacaga
gaaacaggggagacgtatattttccagattgaaagctccggacagtggctggcagaatat
ggctctgcacagggcggaaatctgtatcttgccttaagcggcgccacagagcaggagcat
ggctggtataagaatctgaaaccgggagaaagctttacaaccgttccggcaggggcagcg
gttgtaaaaggtggcctgaatccggcagcagcggcactgaccagatatcggagaaaagta
cgcagaccgaatacggacgatgagaagctgaacgtggtatttaatgattatatgaactgc
ctgatgggagaccctacaacggagcgggagctttccatcattgacaaggcagcagagctc
ggatgcgaatattactgcctggatgcaggctggtatgacgacggattctggtgggaccgt
gtcggggaatggaaagaagcatccggaagattccccaatggtctgaaagaagtctgcgat
catgcacacagtaaaggcctgaaaatgggactctggctggaaatcgaggttatgggagtt
gcctgcgaactggcaaacaagcttccggatgactggtttgtctgtcgtcatggaaaacgc
cacattgacaataaacgctatatgctggatttccgcaatccggaggtacggaaatattgc
cgtgatgtagtagacagactgatcaatgattacggtgtagagtactttaaagtggactat
aacgtaaccatgggatatggaagtgatctgaacagtgacagctgtgcagatgccatccgt
gagcattatgaatgtcttcaccagtggtatgaggaaatcttccgggatcatccggagctt
gttgtggagaactgcggttccggcggacagcgtatggattatggtatgctgaagatctta
agcctgcagtctaccagtgatcagacagattatctctacaatgccaatatcgctgccaat
gtagccagtgcggtaactccggagcagggtggtatgtgggtatatccgtatgaggatgaa
gaagagcatgtgatctacaatgtagtaaatggtatgcttctccgcccatatatcagcggt
atggtatggaagctgggcgaaaattccatgaaccgtatgaaggagggaatctccctgtat
aaggagatccgtgaggaagtccgtgacggcgtgccgttcttcccgcttggttttggaact
ctgaaatctgaagttcttgcttacggagtgaaagcagagaagaatacctatctttcggta
tggacaccgggaacaacagaagcagtgatcccgctggaaaatgcagagcaggtccgcaga
gtatccgtgatctatccgaaggaagagatgtgcggatataagatcgaaaatggaaatctt
gtagtgaagatgccacaggaaaaagcggccagactgtttaagatcgagatgaaatag

DBGET integrated database retrieval system