KEGG   Rhodomicrobium vannielii: Rvan_0052Help
Entry
Rvan_0052         CDS       T01353                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rva  Rhodomicrobium vannielii
Brite
Enzymes [BR:rva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rvan_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
56478..57146
Genome map
AA seq 222 aa AA seqDB search
MNFATARLHMVESQIRPNGVRDPLILDAFASLPRELFVPEQRQHLAYIDEGVLAVEAAAD
EPARYLLQPMVLARLLEAAEPRREDHVLDVGGATGYGAAILSRLAAKVDALETSAALAEA
MRKRLSFVGASNVDVHAGPLEKGVPSKKPFDLIVVNGAVADEPKTLLEQLADGGRLVAVV
RKGWLGRAWLYEKSGDSVSGRPLFDAPADYLPGFEPQPQFTF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcaacggcgcggcttcacatggtcgaatcgcaaatcaggccgaacggggtg
cgcgacccgctcatactggacgcgtttgcgtcgctgccgcgcgagctgttcgtcccggag
cagcgacagcacctcgcctatatcgacgagggcgtgctcgccgtggaagccgcggccgat
gagcccgcgcgttatcttcttcagccgatggttctcgccaggctccttgaggcggcggag
cctcgccgggaggatcacgtgctcgacgtcggcggcgcaacgggctacggcgcggcgatc
ctgtcgcgactcgccgccaaggtcgacgcactcgagacgtcggccgcgctcgccgaggct
atgaggaagcgtctttcctttgtgggggcgagcaacgtggacgttcacgcggggccgctt
gaaaaaggcgtgccctcgaaaaagccgttcgatctcatcgtggtaaatggcgcggttgcc
gacgaaccgaagaccttgctcgaacagcttgccgatggcggaagactcgttgccgtcgta
cgcaagggctggcttggccgcgcatggctttatgaaaagagcggcgacagcgtttcggga
cgcccgctattcgacgcgcccgcagattatcttcccggcttcgaaccgcagccgcagttc
acattctag

DBGET integrated database retrieval system