KEGG   Rhodomicrobium vannielii: Rvan_0052Help
Entry
Rvan_0052         CDS       T01353                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rva  Rhodomicrobium vannielii
Brite
Enzymes [BR:rva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rvan_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_23 Methyltransf_11 MTS Methyltransf_PK Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: ADP69342
JGI: Rvan_0052
UniProt: E3I4Y8
Position
56478..57146
Genome map
AA seq 222 aa AA seqDB search
MNFATARLHMVESQIRPNGVRDPLILDAFASLPRELFVPEQRQHLAYIDEGVLAVEAAAD
EPARYLLQPMVLARLLEAAEPRREDHVLDVGGATGYGAAILSRLAAKVDALETSAALAEA
MRKRLSFVGASNVDVHAGPLEKGVPSKKPFDLIVVNGAVADEPKTLLEQLADGGRLVAVV
RKGWLGRAWLYEKSGDSVSGRPLFDAPADYLPGFEPQPQFTF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcaacggcgcggcttcacatggtcgaatcgcaaatcaggccgaacggggtg
cgcgacccgctcatactggacgcgtttgcgtcgctgccgcgcgagctgttcgtcccggag
cagcgacagcacctcgcctatatcgacgagggcgtgctcgccgtggaagccgcggccgat
gagcccgcgcgttatcttcttcagccgatggttctcgccaggctccttgaggcggcggag
cctcgccgggaggatcacgtgctcgacgtcggcggcgcaacgggctacggcgcggcgatc
ctgtcgcgactcgccgccaaggtcgacgcactcgagacgtcggccgcgctcgccgaggct
atgaggaagcgtctttcctttgtgggggcgagcaacgtggacgttcacgcggggccgctt
gaaaaaggcgtgccctcgaaaaagccgttcgatctcatcgtggtaaatggcgcggttgcc
gacgaaccgaagaccttgctcgaacagcttgccgatggcggaagactcgttgccgtcgta
cgcaagggctggcttggccgcgcatggctttatgaaaagagcggcgacagcgtttcggga
cgcccgctattcgacgcgcccgcagattatcttcccggcttcgaaccgcagccgcagttc
acattctag

DBGET integrated database retrieval system