KEGG   Rhodomicrobium vannielii: Rvan_0094Help
Entry
Rvan_0094         CDS       T01353                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rva  Rhodomicrobium vannielii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_0094
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0094
   00650 Butanoate metabolism
    Rvan_0094
  Energy metabolism
   00190 Oxidative phosphorylation
    Rvan_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(109674..110066)
Genome map
AA seq 130 aa AA seqDB search
MPSTTYRTELKKVRGLGSAIGGPGTDHFWAQRLTAVSNLFVVAFLVYTGLTLAGAPLGDV
KAFFGHPFNAIASILVVISTAIHMRLGMQVPVEEYMPHGLKVPFLFLNTFFVIVIAVVGV
LSILKLFLGN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgacaacctatagaacagaactcaagaaggttcgcggcctcggctctgccatc
ggcggccccggcacagaccatttctgggcgcagcgcctcacggctgtgtcgaacctcttc
gtggtggcgttcctcgtctacaccggcctgacgctggcgggcgcgccgctcggcgatgtg
aaggcgttcttcggccacccgttcaacgcaatcgcgtcgatcctcgtggtgatctcgacc
gccatccatatgcgcctcggcatgcaggttccggtcgaggaatacatgccccacggcctc
aaggttccgtttctcttcctgaacacattcttcgtgatcgtgatcgccgtcgtcggcgtg
ctgtcgatcctgaagcttttccttggaaattag

DBGET integrated database retrieval system