KEGG   Rhodomicrobium vannielii: Rvan_0100Help
Entry
Rvan_0100         CDS       T01353                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rva  Rhodomicrobium vannielii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rva01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rva00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
114064..115182
Genome map
AA seq 372 aa AA seqDB search
MISAIHLTQELIRFDTVNPPGNEAPCARYLGGILDAAGFSIKHPSIGDNRENLIAVIGGT
SEKRPICFSGHTDVVPLGAAPWTVEPFGGELAFGRVHGRGSSDMKGGVAAFVAAAVKLAP
RLEGTPGLVLVITAGEERGCEGSNHMKKHGLLPPAGAIVIGEPTANRPLAGHKGVFWLEG
VAKGVTAHGSMPEQGVNAVYKAARAALALEAFDFSGDSHPVLGRPTVNVGWLKGGMNINS
VPDEARLGLDVRIVPGLDRKELVERFTRAAGGCVSFHVMSTADPVWTDPNDPWMADVIHV
VGDVTGNEPTFGGAPYFTDAGALKPGMGNPPVVILGPGEPEQAHQTDEWCSVQRIEEAEA
IYTDLIVRWCGL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatttccgccatccacctcacgcaagagctgatccgcttcgacaccgtcaacccgccg
gggaacgaagccccatgcgcgcgctatctcggcggcatcctcgacgcggcgggcttctcg
atcaagcacccgagcatcggcgacaaccgcgagaacctcatcgcggtcatcggcggcacc
tccgagaagcggccgatctgtttttcgggccataccgatgtcgtgccgctcggcgccgcg
ccgtggacggtcgagccgttcggcggcgagctggctttcgggcgcgtccatgggcgcggg
tccagtgacatgaagggtggcgtcgcggcttttgtcgcggcggccgtcaagctcgcgcct
cggctcgaaggcacgcccggcctcgtgcttgtcatcacggcgggcgaggagcgcggctgc
gaaggctcgaaccatatgaagaagcacgggctgctgccgcccgctggcgcgatcgtcatc
ggcgagccaacagctaaccgcccgcttgccgggcacaagggcgtgttctggctcgaaggc
gtggcgaagggcgtcacggcgcacggctccatgcccgagcagggcgtgaacgcggtctac
aaggcggcgcgcgctgcgttggcgctcgaagcgttcgacttttcaggcgactcgcatccg
gtgctcggccgcccgacggtgaatgtcggctggctcaagggcggcatgaatataaactcg
gtgccggacgaggcgcggctcggcctcgacgtgcgcatcgtgcccggcctcgaccgcaag
gaactcgtggagcgcttcacgcgtgcggcgggtggctgcgtgtcgttccacgtcatgagc
acggcggacccggtgtggaccgatccgaacgacccgtggatggcggacgtcattcatgtg
gtgggcgacgtgacgggcaatgaaccgacattcggcggcgcgccgtatttcacggacgcg
ggcgcgcttaagcccggcatgggcaacccgccggtcgtcatcctcggccccggcgagccg
gaacaggcgcaccagaccgacgaatggtgctccgtccagcgcatcgaggaggccgaggcg
atttacaccgacctcatcgtgcgctggtgcgggctttag

DBGET integrated database retrieval system