KEGG   Rhodomicrobium vannielii: Rvan_0234Help
Entry
Rvan_0234         CDS       T01353                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rva  Rhodomicrobium vannielii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rva01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rva00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
278373..279542
Genome map
AA seq 389 aa AA seqDB search
MTLSGTQSARIALDARPEWRNQRRIAIKIGSALLTDSETGTLKKAWLEAIGDDVAELKAQ
GREVILVSSGAIALGRRALGLAPGALKLEEAQASAAVGQVTLAHAYQTVFRERGITTAQI
LVTPGDTEERRRYLNARSTIATLLKLGAVPVVNENDTVATAEIRYGDNDRLAARVATMMT
ADCLVLLSDIDGLYTAPPAKNPHAQHIDVVTQITPEIEAMAGDAGTELSRGGMVTKITAA
KLAVSAGTHMVIASGKELHPLRALANGAPCTWFLASANPVAARKRWIAGTLEPKGVVLID
DGAARALRSGRSLLPAGVTGVSGAFERGEAVIIRDGHGCEIGRGLIAYCAEEAARIAGRS
SHEIEATLGYAGRAALIHRDDLALLHDLD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctctggcacacaatccgcgcggatagccctcgacgcgcgccccgaatggcga
aaccagcgccgtatcgcgataaagatcggctcggcgctgctgaccgacagcgaaaccggc
acgctgaaaaaggcgtggctcgaagccatcggcgacgatgtggcggagctgaaggcgcaa
gggcgcgaggtcatccttgtgtcgtcgggcgcgatcgcgctcggtcgccgcgcgctcggg
ctcgcacccggtgcgctcaagcttgaagaggcgcaggcctcggcggccgtcgggcaggtg
acgctcgcgcacgcctatcaaacggtattccgcgagcgcggcattaccacggcgcagatc
ctcgtgacgccgggcgataccgaagagcgccgccgctatctcaacgcccgcagcaccatc
gcgacgcttctgaagctcggcgcggttcccgtggtgaacgagaacgacacggtggcaacc
gccgaaatccgctatggcgacaacgaccgcctcgcggcgcgcgtcgccaccatgatgacg
gcggactgcctcgtgctcctgtccgacatcgacgggctttacaccgcgccgcccgcaaaa
aatcctcacgcccagcatatcgatgtcgtgacgcagatcacgcccgaaatcgaggcgatg
gcgggcgacgcgggcacggagctttcgcgcggcggcatggtgacgaagatcaccgccgcg
aagctcgccgtctcggcgggaacgcatatggtgatcgcgagcggcaaggagcttcatccg
ctgcgcgcgctggccaacggcgcaccctgcacatggtttctcgcttcggcgaacccggtc
gcggctcgcaagcgctggatcgcgggtacgctcgaaccgaaaggcgtcgtgctcatcgac
gatggcgcggcgcgggcgttgcgctccgggcgcagcctcctgccggcgggcgtcaccggc
gtcagcggcgcattcgagcgcggcgaggcggtcatcatccgcgacggccatggctgcgaa
atcgggcgggggctcatcgcctactgcgccgaggaagccgcgcgcatcgccgggcgcagt
tcccacgaaattgaggcgacgcttggctatgccgggcgggcggcgctcattcatcgcgac
gacctggcgcttttgcacgacctcgactaa

DBGET integrated database retrieval system