KEGG   Rhodomicrobium vannielii: Rvan_0339Help
Entry
Rvan_0339         CDS       T01353                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rvan_0339
Enzymes [BR:rva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rvan_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(397172..398197)
Genome map
AA seq 341 aa AA seqDB search
MIGSDMATHGVSPAAELIGITRNPVPGGAICGTFASRDGLQIRYARWDTTAERRIGTVCL
FHGRTEFIEKYFETIGDLRRRGFAVATMDWRGQGGSSRMLKNRSKGHAENFAQFDDDVRR
FMSSIVLPDCPPPYYCLAHSMGGHLVLRLAQTKVCWWDRIVLTAPMIDFAQTEKRKGLIG
LGAEVLTLLGFGDSFIPGGKAQLWERAPFDGNPLTSDRLRYERAQDVLRASPGLGIGAPT
IGWVQAACASVATLASTAFMESIRVPTLIVAASNDQIVSNTAMERFASHVKNCRLIVVSG
ARHEILMERDQLRDQFWAAFDAYVPGSTLLPRRLEQPEIAL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcggctcggatatggcgactcacggcgtttcaccggcagccgaattgatcggcatc
acccgcaatcccgtgccgggcggcgccatatgcggcacgttcgcttcgcgcgacggcttg
cagattcgctatgcccggtgggacacgacggccgagcgacgcatcggtacggtctgtctt
ttccacgggcgcacggagttcatcgagaaatatttcgagaccatcggcgacctgcgccgc
aggggcttcgccgtcgcgaccatggactggcgcgggcagggcggctcctcgcgcatgctg
aagaaccgctccaagggccacgccgagaacttcgcgcaattcgacgacgacgttcgccga
ttcatgtcgagcatcgtgctgccggactgccccccgccctattattgcctcgcgcattcg
atgggcggacacctcgtgctacgtctcgcgcaaacgaaggtttgctggtgggatcgcatc
gtgctcaccgcgccgatgatcgatttcgcgcagaccgagaagcgcaaggggcttatcggc
ctgggtgccgaagtgctgacgctgcttggctttggcgacagtttcattccgggcggcaag
gctcagctttgggagcgcgcgccgttcgacggcaacccgctgacgtcggatcggctgcga
tacgagcgcgcgcaagacgtgcttcgcgcgtcgccggggctcggcatcggcgcgccgact
atcggctgggtacaggccgcctgcgcctccgtcgcgacgctcgcctcgacggcattcatg
gagagcatccgcgtgccaaccctgattgtcgcggcgagcaacgatcagatcgtgtccaac
actgcgatggagcgtttcgcgagccacgtgaagaactgccgcctcatcgtcgtttcgggc
gcgcgccacgagatcctcatggagcgtgaccagctccgcgaccagttctgggctgcgttc
gacgcctatgttccgggctcgacgctgctgccgcgacggctggagcagcctgaaatcgcg
ctttga

DBGET integrated database retrieval system