KEGG   Rhodomicrobium vannielii: Rvan_0371Help
Entry
Rvan_0371         CDS       T01353                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01130  Biosynthesis of antibiotics
rva01230  Biosynthesis of amino acids
Module
rva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rvan_0371
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rvan_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADP69657
JGI: Rvan_0371
UniProt: E3I7P1
Position
435887..436708
Genome map
AA seq 273 aa AA seqDB search
MSILDRIVAYKKEEVAAAKAQVSLAELEERAAAAPRVRDFFDALSRRVAVVEPALIAEVK
KASPSRGLIRPDFDPAAIARAYEAGGANCLSVLTDGPSFQGTPAYLVAAREACSLPVLRK
DFMVDPYQVTEARAMGADCILVIMACTTDALAEELIAAASTHNMDVLVEVHNEDELARAL
ALDSWLIGINNRDLNSFETHLETTERLARLIPPGRIIVSESGIFAPADIARLMREGAGAF
LVGESLMRHDDVEAATRALLGGSARGERQAATA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctcgaccgcattgtcgcctacaagaaagaggaagtggccgccgcgaaagcg
caggtttcgcttgccgagcttgaggagcgcgccgccgctgcgccccgcgtccgcgacttc
ttcgacgctctgtcgcgccgcgtcgccgtggttgagcccgcgctgatcgccgaggtgaag
aaggccagcccgtcgcgcggactgatccgcccggatttcgaccctgccgccatcgcgcgc
gcctatgaagcgggcggcgcgaactgcctctccgtgttgacggatggcccctcgttccag
ggcacgcccgcctatctcgtcgccgcgcgcgaggcgtgctcgctgccggtgctgcgcaag
gatttcatggtcgatccctatcaggtgacggaggcgcgcgcgatgggcgcggattgcatc
ctcgtcatcatggcttgtacgaccgacgcgctggccgaagagctgatcgcagccgcgagc
acgcacaacatggatgtgctggtcgaggtgcataacgaagatgaactcgcccgcgcgctc
gccctcgattcctggctgatcggcatcaacaaccgcgacctcaacagcttcgagacgcat
ctcgaaacgacggagaggctggcgcggctcatccctccggggcggattatcgtttccgaa
agcggcattttcgcccccgccgacattgcaaggctcatgcgcgaaggcgcgggcgcgttc
ctcgtcggcgaaagcctcatgcgccatgacgacgtcgaggccgcgacgcgcgcgcttctc
ggcggttcggctcgcggcgaaaggcaggcagccaccgcatga

DBGET integrated database retrieval system