KEGG   Rhodomicrobium vannielii: Rvan_0371Help
Entry
Rvan_0371         CDS       T01353                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rva  Rhodomicrobium vannielii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rvan_0371
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rvan_0371
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rvan_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
435887..436708
Genome map
AA seq 273 aa AA seqDB search
MSILDRIVAYKKEEVAAAKAQVSLAELEERAAAAPRVRDFFDALSRRVAVVEPALIAEVK
KASPSRGLIRPDFDPAAIARAYEAGGANCLSVLTDGPSFQGTPAYLVAAREACSLPVLRK
DFMVDPYQVTEARAMGADCILVIMACTTDALAEELIAAASTHNMDVLVEVHNEDELARAL
ALDSWLIGINNRDLNSFETHLETTERLARLIPPGRIIVSESGIFAPADIARLMREGAGAF
LVGESLMRHDDVEAATRALLGGSARGERQAATA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctcgaccgcattgtcgcctacaagaaagaggaagtggccgccgcgaaagcg
caggtttcgcttgccgagcttgaggagcgcgccgccgctgcgccccgcgtccgcgacttc
ttcgacgctctgtcgcgccgcgtcgccgtggttgagcccgcgctgatcgccgaggtgaag
aaggccagcccgtcgcgcggactgatccgcccggatttcgaccctgccgccatcgcgcgc
gcctatgaagcgggcggcgcgaactgcctctccgtgttgacggatggcccctcgttccag
ggcacgcccgcctatctcgtcgccgcgcgcgaggcgtgctcgctgccggtgctgcgcaag
gatttcatggtcgatccctatcaggtgacggaggcgcgcgcgatgggcgcggattgcatc
ctcgtcatcatggcttgtacgaccgacgcgctggccgaagagctgatcgcagccgcgagc
acgcacaacatggatgtgctggtcgaggtgcataacgaagatgaactcgcccgcgcgctc
gccctcgattcctggctgatcggcatcaacaaccgcgacctcaacagcttcgagacgcat
ctcgaaacgacggagaggctggcgcggctcatccctccggggcggattatcgtttccgaa
agcggcattttcgcccccgccgacattgcaaggctcatgcgcgaaggcgcgggcgcgttc
ctcgtcggcgaaagcctcatgcgccatgacgacgtcgaggccgcgacgcgcgcgcttctc
ggcggttcggctcgcggcgaaaggcaggcagccaccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system