KEGG   Rhodomicrobium vannielii: Rvan_0534Help
Entry
Rvan_0534         CDS       T01353                                 

Definition
magnesium chelatase ATPase I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rva00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
608014..609042
Genome map
AA seq 342 aa AA seqDB search
MTRPVYPFSAIVGQDELKLALIISAIDPSIGGVLAFGDRGTGKSTTVRALAALLPPVRAV
RDCRFNCDPDGSNLCEECREKLREGEKLVARFIRVPVVDLPLGATEDRVVGALDLEKALT
RGEKAFETGLLARANRGFLYIDEVNLLEDFLVDLLLDVAASGENVVEREGMSLRHPARFV
LIGSGNPEEGELRPQLLDRFGLSVEVRTPQDLASRIEVVRRRDGFERDPHGFAAAWRGEN
RKLRRKVATARARVNLIAVPDSILEDSAKLCLALGTDGLRGELTLMRAARALAAYEGAET
VTQKHLISIAPPALRHRLRRDPLDEAGSSVRVDMALEKAFSA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcccagtttatcctttttccgccatcgtaggacaagacgagctcaagcttgcc
ttgatcatctccgctatcgatccatcgattggcggcgtcctggctttcggtgatcgcgga
accggcaagtcgaccacggttcgggcgcttgccgcactgcttcccccggttcgcgccgtg
cgcgattgccgcttcaactgcgaccccgacgggtccaacctgtgcgaggaatgccgcgag
aagctgcgcgaaggcgagaagctcgtcgcgcgcttcatccgcgtgccggtggtcgacctg
ccgctcggtgcgacggaagatcgcgtcgtgggcgcgctcgacctcgaaaaggcactgacg
cgcggcgagaaagcattcgagacggggcttctggcccgcgctaatcgcggcttcctctat
atcgacgaagtgaacctcctcgaagacttcctcgtggacctgctgctcgacgtggcggct
tccggcgagaacgtcgtcgagcgcgagggcatgagcctgcgccatcccgcgcgcttcgtg
cttatcggttccggtaacccggaagagggcgagcttcgcccgcagcttctcgaccgcttc
ggcctttcggttgaggtgcgtacgccgcaggatctggcatcgcgcatcgaggtcgtccgc
cgccgcgacggcttcgagcgtgatccgcacggcttcgcggccgcgtggcgcggtgaaaac
cgcaagctccgccgcaaggtggcgaccgcgcgcgcccgcgtcaacctcatcgccgtgccg
gattcgatcctcgaagattcggccaagctctgcctcgctctcggcaccgacgggcttcgc
ggcgaacttacgctgatgcgtgccgcccgcgcgctcgccgcgtatgagggcgcggaaacc
gtgacgcaaaagcatctcatatccatcgcgccgcccgccctgcgccatcgcctgcgccgc
gatccgctcgacgaggcgggttcgtcggtgcgcgtcgatatggcgcttgagaaagcgttc
agcgcatga

DBGET integrated database retrieval system