KEGG   Rhodomicrobium vannielii: Rvan_0535Help
Entry
Rvan_0535         CDS       T01353                                 

Definition
von Willebrand factor A
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rvan_0535
Enzymes [BR:rva01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rvan_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
609042..610856
Genome map
AA seq 604 aa AA seqDB search
MNGGGEAEERSLWEEAVMAASLFAVDPVGLGGIAVASKYGPVRDSWMDFLRSIVPGWAPF
RKLPLYAADERLFGGLDLAATLARGKPVAERGLLAEMDRGFLVIPSAERMESGLASRLGL
VIDAGAVHVEREAASLMHPARFGVIALDESESGDDETPPAALLERLGLRIDLTDVTWRDV
GLSDTTLEEIEAAQARLPKVVVPDNIIAGLVSAAVSFGIQTLRAPVFAVRAARASAALAG
RDEANEEDAGLAAMFVLAPRATRMPEPMEDQAPPEPPPPEPQDDKEEDGKGGGESGENET
APEDDKALTDMIIAAAAAAMPKEMLVKAAAKPFRVPPSAPMGKAGAERTNAARGRPAGVR
RGMPKPGSPLSLLETLRAAAPWQKIRKSMLDKAIGAGGRLDRIEVRSDDFRIKRLKARSQ
TATIFAVDASGSAAMQRLAETKGAVELLLAECYIRRDQVALVAFRGTRAEILLPPTRSLT
RAKKSLAALAGGGGTPLASGIDAAGALALNIRRRGISPLVVFLTDGKANIAADGKPGRER
AQNDANTAGRRLRAEGIATILVDTSPRPQVQAEKLAQEMAARYVPMPYANAAAISKAAKM
AAKG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggcggcgaggcggaagaacgctcgctgtgggaagaagccgtcatggcggct
tccctgttcgccgtcgacccggtggggcttggcggtatcgccgtcgcctcgaaatacggg
ccggtgcgcgacagctggatggacttcctgagaagcatcgtgccgggctgggcgccgttc
cgcaagctgccgctctacgcggcggacgagcggttgttcggcggcttggacctcgcggcg
acgctcgcgcgtggcaagccggtcgccgagcgcggccttctcgctgaaatggatcgcggc
ttcctcgtcatcccatcggccgagcgcatggagtcggggctagcctcgcggctcggcctc
gtgatcgacgcgggcgcggtgcatgtggagcgcgaggcggcttcgctgatgcatcccgcg
cgcttcggcgtgatcgcgctcgacgagagcgagtctggcgacgacgaaacgccacccgcc
gcgcttctggagcgcctcggccttcgcatcgaccttaccgacgtgacgtggcgcgatgtc
ggcctgtccgatacgacgctcgaagagatcgaggcggcgcaggcgcgtctgccgaaggtc
gtcgtgcccgataacatcatcgcggggcttgtatcggccgccgtgtcgttcggcatccag
acgcttcgcgcgccggtttttgccgtccgtgccgctcgcgcttcggcggcgcttgcgggc
cgcgacgaagccaacgaggaagacgcagggcttgccgcaatgttcgtgctcgcccctcgc
gcgacgcgcatgcccgagccgatggaagatcaggctccgcccgagccacctccgccggag
ccgcaggacgacaaggaagaggacggcaagggcggtggcgagagcggcgagaacgaaacc
gcccccgaggacgacaaggcgcttaccgacatgatcattgcggcagccgctgccgcaatg
ccgaaggaaatgctggtgaaggccgccgcgaagccgtttcgcgtgccgccatccgcgccc
atgggcaaggccggggccgaacgcacgaatgccgcgcgcggccgtccggctggcgtgcgc
cgtggcatgcccaagcccggatcgccgttgagcctgctcgaaacgctgcgggccgcagca
ccgtggcagaaaattcgcaaatcgatgctcgataaggcgatcggcgccggtggacgcctc
gacaggatcgaggtccgaagcgacgacttccgcatcaagcggctgaaggcgcgctcgcag
accgccacgatcttcgctgtcgacgcctccggctccgccgccatgcagcgcctcgccgag
acgaagggcgcggtcgagcttctgctcgccgaatgctacatccgccgcgatcaggtggcg
ctcgtcgcctttcgtggcacgcgggcggaaattctcctgccgccgactcggtcgctgacg
cgcgccaagaaaagcctcgcggcgctcgcgggcggcggcggtacaccgctcgcctcgggc
atcgatgcggctggcgcgctggcgctcaacatccgccgtcgaggcatctcgcccctcgtc
gtgttcttaaccgacgggaaagccaatatcgcggcagacgggaagccgggccgcgaacgc
gctcaaaatgacgcgaacacagccggtcggcgcttgcgcgcggagggtatcgccacgatc
ttggtagatacatctccgaggccgcaggtgcaggctgagaagcttgcgcaggagatggcg
gcacgctacgtgccgatgccctacgcgaacgcggccgcgatatcgaaggctgcgaaaatg
gctgctaagggatga

DBGET integrated database retrieval system