KEGG   Rhodomicrobium vannielii: Rvan_0558Help
Entry
Rvan_0558         CDS       T01353                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00071  Fatty acid degradation
rva00280  Valine, leucine and isoleucine degradation
rva00281  Geraniol degradation
rva00310  Lysine degradation
rva00362  Benzoate degradation
rva00380  Tryptophan metabolism
rva00410  beta-Alanine metabolism
rva00640  Propanoate metabolism
rva00650  Butanoate metabolism
rva00903  Limonene and pinene degradation
rva00930  Caprolactam degradation
rva01040  Biosynthesis of unsaturated fatty acids
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
rva01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rvan_0558
   00650 Butanoate metabolism
    Rvan_0558
  Lipid metabolism
   00071 Fatty acid degradation
    Rvan_0558
   01040 Biosynthesis of unsaturated fatty acids
    Rvan_0558
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rvan_0558
   00310 Lysine degradation
    Rvan_0558
   00380 Tryptophan metabolism
    Rvan_0558
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rvan_0558
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rvan_0558
   00281 Geraniol degradation
    Rvan_0558
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rvan_0558
   00930 Caprolactam degradation
    Rvan_0558
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rvan_0558
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rvan_0558
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rvan_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N NAD_binding_2 DAO F420_oxidored NAD_binding_8 UDPG_MGDP_dh_N 2-Hacid_dh_C DFP AlaDh_PNT_C Shikimate_DH ApbA Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ADP69839
JGI: Rvan_0558
UniProt: E3HZ93
Position
631870..634044
Genome map
AA seq 724 aa AA seqDB search
MSSISYQVDADGIATLTIDQPGKSMNVISPEFTEELSEAIERAAADSSVKGIVITSGKSS
FVAGADLIGMSGMIEHARNAPAAEALKVSSRLTEVLRRLETIGKPVATAINGTALGGGFE
IALATHYRVAADDESIKIGQPEVQVGLLPGAGGTQRIPRLIGIMASAPLLLEGKHLSPQQ
AKSSGLIHDVVPAAELLAKAKAWLLSPQAKSVQPWDERGFKVPGGAGGMHPAAAQLFMAA
NAMTRDKTLGNYPAAQAILSAVYEGTQVPIDLGLKIEAKYFLSLLRGPVAPAMIRTLFVN
KGRADKLVRRPQGVPKAKFKKIGMLGAGMMGAAIAYVAASNGIEVVLLDRDVEAAERGKG
YARKLVEKAVSRRKTTEADGQGLLARIHATADYADLADVDYIIEAVFEDRAIKADVTKKV
EAVIRPDVIFGSNTSTIPITSLAEASERPEKFIGIHFFSPAEKMPLVEIIRGKKTSDEAL
AVTLDFVQAIRKTPIVVNDGRGFFTSRFCMNYIGEGEIMLTEGIPAALVENAGKLAGMPV
GPLALADETAIDLGWKIHKAAETDLGDAYTPSAAIGVMEAMYVKNGRAGRKNGKGFYEYP
EGGPKTLWAGLADLFPVKPESEWPSIDDLKKRLLFAQALDAVRTMEDGVLTDPEDGDVGG
IFGLGFAPYTGGPLSMLDGIGIANAVAECERLAARYGERFSPPKLLRDMAAEGRTFYPAA
KAAA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatctcctatcaagtcgacgcggacggcatcgccacgctcaccatcgaccag
ccgggcaagtcgatgaacgtcatcagccctgaattcaccgaggaactcagcgaggccatc
gagcgcgccgccgccgattcgagcgtgaagggcatcgtcatcacctccggcaagtcgagc
ttcgtcgcaggcgcggaccttatcggcatgtcgggcatgatcgagcacgcgcgcaatgct
ccggccgcggaggcgctgaaggtctcgtcgcgtctcaccgaagtgctgcgccgcctcgaa
accatcggcaagccggtcgcgaccgcgatcaacggcacggcgctcggcggcggcttcgag
atcgcgctagccacgcattaccgcgtcgcggcggatgacgagtccatcaagatcggccag
cccgaggtgcaggtcggcctgctgccgggcgcgggcggcacgcagcgcattcctcgcctc
atcggcatcatggcgtccgcgccgctgctgctcgaaggcaagcacctgtctcctcagcaa
gcgaagtcgtccggtctcatccacgatgtcgtgcccgcggctgagcttctcgcaaaggcg
aaggcgtggcttctgtccccgcaggcgaaatcagtccagccgtgggacgagcgcggcttc
aaggtgccgggcggcgcgggcggcatgcatcccgctgcggcgcagcttttcatggccgcc
aacgccatgacgcgcgacaagacgctcggcaattatccggccgcgcaggcgatcctctcg
gcggtttatgaaggcacgcaggtgccgatcgacctcggcctcaagatcgaggcgaaatat
ttcctctcgctgctgcgcggccccgtcgcgcccgcgatgatccgcacgctgttcgtcaac
aagggccgggcggacaagctcgtgcgccgtccgcagggcgtgccgaaggcgaagttcaag
aagatcggcatgctgggcgcaggcatgatgggcgcggccatcgcctatgtcgcggcgtcg
aacggtatcgaggtggtgcttctcgatcgcgacgtggaagcggccgagcggggcaagggc
tacgcgcggaagctcgtggagaaggccgtttcgcgccgcaagacgacggaggcggacggg
caggggttgctggctcgcatccacgccacggccgattacgccgacctcgctgatgtcgat
tacatcatcgaggccgttttcgaggatcgcgccatcaaggccgacgtgacgaaaaaggtc
gaagccgtgatccggcccgacgtgatcttcggctcgaacacgtccaccatcccgatcacc
agcctcgcggaagcgagcgagcggcctgagaagttcatcggcatccacttcttttcgccc
gccgagaagatgccgcttgtcgagatcatccgcggcaagaaaacaagcgacgaggcgctg
gcggtcacgctggactttgtgcaggcgatcaggaagacgcccatcgtcgtcaatgacggg
cgcggcttcttcacctcgcgcttctgcatgaactacatcggcgagggcgagatcatgctg
acggaaggcattccggcggcgctggtcgagaatgcgggcaagcttgcgggcatgccggtc
gggccgctcgcgctcgcggacgagacggccatcgacctcggctggaagatccacaaggcg
gccgaaaccgacctcggcgacgcctatacgccgagcgccgccatcggcgtgatggaagcc
atgtacgtcaagaacgggcgcgcgggccgcaagaatggcaagggcttctacgagtatccc
gagggcgggccgaagacgctttgggcgggtctcgcggaccttttcccggtgaagcccgaa
agcgagtggccgagcatcgacgacctcaagaagcggctcctcttcgcgcaggcgctcgac
gcggtgcggaccatggaagacggcgtgctcaccgacccggaagacggcgatgtgggcggc
atcttcggcctcggcttcgcgccctacaccggcgggccgctgtcgatgctcgacggtatc
ggcatcgcgaatgccgtcgcggagtgcgagcggctcgccgcgagatatggcgagcggttc
tcgccgccgaagctgttgcgcgacatggcggcggaagggcggacgttctacccggcggcg
aaggctgctgcttag

DBGET integrated database retrieval system