KEGG   Rhodomicrobium vannielii: Rvan_0647Help
Entry
Rvan_0647         CDS       T01353                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rva  Rhodomicrobium vannielii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_0647
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0647
   00640 Propanoate metabolism
    Rvan_0647
   00660 C5-Branched dibasic acid metabolism
    Rvan_0647
Enzymes [BR:rva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rvan_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
725994..727193
Genome map
AA seq 399 aa AA seqDB search
MNVHEYQAKAILKEYGVPVPKGHAAFTPEEAFAVAKELGGPIAVVKAQIHAGGRGKGSFK
EPEAGEKGGVRIAKSFDDVRTFADEMLGRTLVTVQTGPEGRVVKRLLIEEGAAIKRELYL
SFLVDRATSRVAVIASTEGGMDIEEVAHDAPEKILTFSIDPASGYSQFHGRKVAFELGLE
GDQVKQCVKLIGSLYKAFVEKDMSQLEINPLIVTEKGDLVCLDAKLNFDSNALYRHPEIV
ALRDLEEEDPAEVLASRYDLSYVKLDGSIGCLVNGAGLAMATMDIIKLYGSEPANFLDVG
GGATKEKVTEAFKIILSDPNVKGILVNIFGGIMRCDIIAEGIIAAAREMSLKVPLVVRLE
GTNVELGKEIIRNSGLAVIPADNLADAAEKIVAEVKKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttcacgaatatcaggcgaaagccatcctgaaagaatacggcgtacctgtgccg
aagggccatgccgccttcacaccggaagaagccttcgcagttgcgaaggaactcggcggc
cccatcgccgtcgttaaggcgcagatccatgccggcggtcgcggcaagggctcgttcaag
gagccggaagcgggcgagaagggcggcgttcgcatcgccaagtcgttcgacgatgtccgc
accttcgcggacgaaatgctcggccgcacgctcgtcaccgtgcagaccggccccgagggc
cgcgtcgtgaagcgcctcctcatcgaagagggcgcggcgatcaagcgcgaactctatctc
tctttcctcgtggaccgcgcgacgagccgcgtggccgtgatcgcctcgaccgagggcggc
atggacatcgaggaagtggcgcacgacgcccccgagaagatcctcaccttctccatcgat
ccggcgtcgggctattcgcagttccatggccgcaaggtggccttcgaactcggcctcgaa
ggcgatcaggtcaagcagtgcgtgaagctgatcgggagcctctacaaggctttcgtcgag
aaggacatgagccagctggaaatcaatccgctgatcgtgaccgagaagggcgacctcgtc
tgtctcgacgcgaagctgaacttcgactcgaacgcgctctaccgtcatcccgagatcgtg
gcgctgcgcgaccttgaagaggaagacccggcggaagtgctcgcgtcccgctatgacctg
tcctacgtgaagctcgacggcagcatcggctgcctcgtgaacggcgccggactcgccatg
gcgacaatggacatcatcaagctctacggttcggagcccgccaacttcctcgacgtcggc
ggcggcgcgacaaaggagaaggtgacggaagccttcaagatcatcctgtccgacccgaac
gtgaagggcatcctcgtcaacatcttcggcggcatcatgcgctgcgacatcatcgcggaa
ggcattatcgccgccgcccgcgagatgagcctcaaggtgccgctcgtcgtgcgcctcgaa
ggcacgaacgtcgaactcggcaaggagatcatccgcaattccggtctcgccgtgatcccg
gcggacaacctcgcggacgcagccgagaagatcgtggccgaggtgaagaaggcggcttga

DBGET integrated database retrieval system