KEGG   Rhodomicrobium vannielii: Rvan_0652Help
Entry
Rvan_0652         CDS       T01353                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00020  Citrate cycle (TCA cycle)
rva00310  Lysine degradation
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
rva01200  Carbon metabolism
Module
rva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0652
  Amino acid metabolism
   00310 Lysine degradation
    Rvan_0652
Enzymes [BR:rva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rvan_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADP69929
JGI: Rvan_0652
UniProt: E3HZX8
Position
732159..733472
Genome map
AA seq 437 aa AA seqDB search
MRLGMRLLKDLCMTTEIVVPTLGESVTEATIGRWFKKPGDAVKADEAVAELETDKVTLEV
NAPAAGVIAEILVKEGETVGVGALLGTIAEGAGAAANGGAPKSAEKSAPAPVAAQATTPS
PVQAASPRSPNVDVLAPSVRRIAEETGINPATISGTGKDGRVTKGDMLSVIEGGAASASV
APSSFFEKAPPPAPAVRPAAPRTIEAREERVRMTKLRQTIARRLKEAQNNAAMLTTFNEV
DMSTIMDLRNRYKTIFEKKHGTKLGFMGFFVKAVLHALHDVPSVNAEIDGDDIIYKNFYH
IGIAVGTDRGLVVPVVRDADHKSVAEIEKEIAGFGVKARDGKLSLEEMQGGTFTISNGGV
YGSLMSTPILNAPQSGILGMHKIQERPVVVNGKIEIRPMMYLALSYDHRLVDGKDAVTFL
VHVKDALEDPQRLILDL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgggatgaggctgttgaaggatttatgcatgaccacggaaatcgtcgttccc
acgcttggcgaatcagtcacagaagcgaccatcggccgatggttcaagaagccgggcgac
gccgtgaaggcagatgaggctgttgccgagcttgagaccgacaaggtcacgctcgaagtg
aatgccccggcggcgggggttatcgccgaaatcctcgtcaaggaaggcgaaacagtcggc
gtcggcgcgctgctcggcacgatcgcggaaggcgcgggcgcggccgcgaacggtggcgca
cccaagtccgccgagaaatcggcacctgcgccggtcgccgctcaggccacaaccccgagc
cctgttcaagccgcttcgccccgctcgccgaacgtcgatgtgctcgccccgtccgtgcgc
cgcatcgccgaggaaaccggcatcaatcccgccaccatttcgggcaccggcaaggatggc
cgtgtgacaaagggcgacatgctttcagtgatcgagggcggcgccgcctctgcgtccgtc
gcgccgagttccttcttcgaaaaggcgccgccgcccgctcccgccgtccgtcccgccgcg
ccgcgcaccattgaagcgcgcgaggagcgcgtgcgtatgacgaagcttcgtcagactatc
gcgcgtcgcctcaaggaagcgcagaacaacgccgcgatgctgaccaccttcaacgaggtg
gacatgtcgacgatcatggatttgcgcaaccgctacaagacgatcttcgagaagaagcac
ggcaccaagctcggcttcatgggcttcttcgtgaaggctgtgctgcatgccctgcatgac
gttccgagcgtcaacgcggagatcgacggcgacgacatcatctacaagaatttctaccat
atcggtatcgcggtcggcacggatcgcggcctcgtcgtgcccgtcgtgcgcgacgcggac
cacaagtccgtcgccgagatcgagaaggagatcgcgggcttcggcgtgaaggcgcgcgac
ggcaagctcagccttgaagagatgcagggcggcacgttcaccatctcgaacggcggcgtt
tacggttcgctgatgtcgacgccgatcctgaatgcgccgcagtcgggcatcctcggtatg
cacaagattcaagagcggccggtcgtcgtgaacggcaagatcgagatccggccgatgatg
tatctcgcgctgtcctacgatcaccggctcgtcgacggcaaggatgccgtgacgttcctc
gtgcatgtgaaagatgcgctggaagatccgcagcgcctcattctggacctttag

DBGET integrated database retrieval system