KEGG   Rhodomicrobium vannielii: Rvan_0652Help
Entry
Rvan_0652         CDS       T01353                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rva  Rhodomicrobium vannielii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_0652
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rvan_0652
  Amino acid metabolism
   00310 Lysine degradation
    Rvan_0652
Enzymes [BR:rva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rvan_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
732159..733472
Genome map
AA seq 437 aa AA seqDB search
MRLGMRLLKDLCMTTEIVVPTLGESVTEATIGRWFKKPGDAVKADEAVAELETDKVTLEV
NAPAAGVIAEILVKEGETVGVGALLGTIAEGAGAAANGGAPKSAEKSAPAPVAAQATTPS
PVQAASPRSPNVDVLAPSVRRIAEETGINPATISGTGKDGRVTKGDMLSVIEGGAASASV
APSSFFEKAPPPAPAVRPAAPRTIEAREERVRMTKLRQTIARRLKEAQNNAAMLTTFNEV
DMSTIMDLRNRYKTIFEKKHGTKLGFMGFFVKAVLHALHDVPSVNAEIDGDDIIYKNFYH
IGIAVGTDRGLVVPVVRDADHKSVAEIEKEIAGFGVKARDGKLSLEEMQGGTFTISNGGV
YGSLMSTPILNAPQSGILGMHKIQERPVVVNGKIEIRPMMYLALSYDHRLVDGKDAVTFL
VHVKDALEDPQRLILDL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgggatgaggctgttgaaggatttatgcatgaccacggaaatcgtcgttccc
acgcttggcgaatcagtcacagaagcgaccatcggccgatggttcaagaagccgggcgac
gccgtgaaggcagatgaggctgttgccgagcttgagaccgacaaggtcacgctcgaagtg
aatgccccggcggcgggggttatcgccgaaatcctcgtcaaggaaggcgaaacagtcggc
gtcggcgcgctgctcggcacgatcgcggaaggcgcgggcgcggccgcgaacggtggcgca
cccaagtccgccgagaaatcggcacctgcgccggtcgccgctcaggccacaaccccgagc
cctgttcaagccgcttcgccccgctcgccgaacgtcgatgtgctcgccccgtccgtgcgc
cgcatcgccgaggaaaccggcatcaatcccgccaccatttcgggcaccggcaaggatggc
cgtgtgacaaagggcgacatgctttcagtgatcgagggcggcgccgcctctgcgtccgtc
gcgccgagttccttcttcgaaaaggcgccgccgcccgctcccgccgtccgtcccgccgcg
ccgcgcaccattgaagcgcgcgaggagcgcgtgcgtatgacgaagcttcgtcagactatc
gcgcgtcgcctcaaggaagcgcagaacaacgccgcgatgctgaccaccttcaacgaggtg
gacatgtcgacgatcatggatttgcgcaaccgctacaagacgatcttcgagaagaagcac
ggcaccaagctcggcttcatgggcttcttcgtgaaggctgtgctgcatgccctgcatgac
gttccgagcgtcaacgcggagatcgacggcgacgacatcatctacaagaatttctaccat
atcggtatcgcggtcggcacggatcgcggcctcgtcgtgcccgtcgtgcgcgacgcggac
cacaagtccgtcgccgagatcgagaaggagatcgcgggcttcggcgtgaaggcgcgcgac
ggcaagctcagccttgaagagatgcagggcggcacgttcaccatctcgaacggcggcgtt
tacggttcgctgatgtcgacgccgatcctgaatgcgccgcagtcgggcatcctcggtatg
cacaagattcaagagcggccggtcgtcgtgaacggcaagatcgagatccggccgatgatg
tatctcgcgctgtcctacgatcaccggctcgtcgacggcaaggatgccgtgacgttcctc
gtgcatgtgaaagatgcgctggaagatccgcagcgcctcattctggacctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system