KEGG   Rhodomicrobium vannielii: Rvan_0788Help
Entry
Rvan_0788         CDS       T01353                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rva  Rhodomicrobium vannielii
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rvan_0788
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rvan_0788
Enzymes [BR:rva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rvan_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
872576..873946
Genome map
AA seq 456 aa AA seqDB search
MDVSFFQEILSKISDRGRQILDLSSLIGTDAEESFEELCQALVSSRGEASGVALARRILD
LYRLTTDKEKDAFFVFLARHFLPSTEAVQRAATAYLEQPEIGRLETLMAAVESPRQELFR
RLNLAPGGTTALVRMREDLLRRLKDNPQLAGVDRDFVHLFSSWFNRGFLVLAHLSWSSPA
SILEKLIAYEKVHKIHGFEDLRRRLDPNDRRCFAFFHPALVDEPLIFVQVALASEIPSSI
QLLLASDAEDFDDPDPSVAVFYSISNCQDGLRGISFGNFLIKQVAEDMKKEKPSLKAFVT
LSPAPTFRSWLEANKAELSYLPAAQRKLIDAALAGQFGESEEELDALEPAILAAAAHYYL
RAKDKKGKPVDPVARFHLGNGARLERINWLGDTSEKGIRESLSVMVNYLYDLKDIERNHE
AYVNLSQVAASKAVRSILLAPEPNAKAAQRKSETIS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttctttcttccaggaaatcctgagcaaaatttcggaccgaggcaggcagatt
ctggatttgtcatccttgatcggaacagacgctgaagagtcattcgaagaattatgtcag
gctttggtttcgagcaggggcgaagcatccggcgttgctcttgcaaggcgaatccttgac
ctctaccgtttgacgacagataaggaaaaagacgcttttttcgtgtttttggcaagacat
tttctcccgagcacagaggcggtccagcgagcggcgaccgcttatcttgagcagccggag
atcggtcggctcgaaaccctcatggccgctgtcgaatcgccgaggcaggaacttttccgc
cgcctcaatctcgcgccgggcggcacgacggctctcgtgcgcatgcgcgaagacctgctg
cgccgtctgaaggataatccccaactcgccggcgtcgaccgcgatttcgtgcatctgttc
tcctcgtggttcaatcgcggcttcctcgtgctcgcgcatctttcctggtcgagcccggcg
tcgatcctcgaaaaattgatcgcctacgagaaggtgcacaagatccacggtttcgaggat
ttgcggcgcaggctcgaccccaacgaccgccgctgcttcgcgttcttccatccggcgctc
gtcgatgaaccgctcatcttcgtgcaggtcgcgctcgcgagcgaaattccgtcgtcgatc
cagctgctcctcgcctccgacgcggaagatttcgacgatccggacccctccgtggcggtc
ttctattccatctcaaactgtcaggatggcctgcgcggaatttccttcggcaacttcctc
atcaagcaggtggcggaggacatgaagaaggagaagccttcgctgaaggccttcgtgacg
ctatcgcccgcaccgactttcaggtcgtggctcgaagcgaacaaggccgagctttcctat
cttccggcggcgcagcggaagctgatcgatgcagcgctcgcgggccaattcggcgagagc
gaggaggaactcgacgcgctcgaacccgccattctcgccgccgccgctcattattatctg
cgcgcgaaggacaagaaggggaaaccggtcgacccggtggcgcgtttccacctcggcaac
ggcgcgcggctggagcggatcaattggctcggcgacacgtcggagaagggtattcgcgag
tctctgagcgtcatggtcaactatttatacgatcttaaggacatcgagcgtaatcacgaa
gcttatgtgaacctgagccaagtggccgcgtcgaaggccgtgagatcgatccttctcgca
ccggaaccgaacgccaaggccgcgcagcgtaaaagcgagacaatctcatga

DBGET integrated database retrieval system