KEGG   Rhodomicrobium vannielii: Rvan_0829Help
Entry
Rvan_0829         CDS       T01353                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rva  Rhodomicrobium vannielii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
921611..922717
Genome map
AA seq 368 aa AA seqDB search
MTLTRREILRLVALGAVSTALDSAGAEEQKPNLRQLGADKRLAIGSAFSTNELNPDDESL
FRHELSRITPENELKMTAIRPTRETFDFARADAIADFARRGGLEMRGHALIWNNDRQPGW
LATLSEAEMRSAIEEHIERTMGRYEGRIEVWDVINEPVGTVAFGDYMLRDGPFVQRLGPD
YIALAFRAARAVAPAAKLVLNETHTERDDRFGRNYRRRLLYIIDRLQDTGVPLDGIGLQG
HLQPDKPFDPHGFGAFLDEIARRKLFIEITELDVNDASFPDDIAARDQAVAATYRRFLRT
ALANPAVRSLSFWQLGDGASWYFAQSVDENPLGQRRPRPLLYDADMRPKLAFDAVADELR
RMPERPRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaacccgccgcgaaatcctccgtcttgtcgcgctcggggccgtgagcaccgcg
ctcgatagtgcaggcgccgaggagcaaaagccgaacttgaggcagcttggtgcggataaa
aggctcgcgatcggctccgcgttctcgacgaacgaactcaatcccgatgacgagagcctc
ttccggcacgaactttcgcggatcacgcccgaaaacgagctgaagatgaccgccatcagg
ccgacgcgcgagacattcgacttcgcacgggccgatgcaatcgccgatttcgcccggcgc
ggcggtctggaaatgcgcggccatgcgctcatctggaacaatgacaggcagccgggttgg
cttgcgacgctctctgaagcggagatgcgctcggccatcgaggagcacatcgaacgcacc
atggggcgctatgagggccgcatcgaggtgtgggatgtgatcaacgagccggtcggcacc
gtcgcgttcggggattacatgctgcgcgacggcccgttcgtccagcgcctcgggccggac
tacatcgcgctcgccttccgcgccgcccgcgccgtcgctcccgccgcaaagctcgtcctg
aacgaaacgcacaccgaacgtgacgaccgcttcggccggaactatcgcagacgcctcctt
tatatcatcgaccgcctccaggataccggcgtgccgctcgacggaatcggcctgcaaggc
catctccaacccgacaagcccttcgatccgcacggtttcggcgcattcctagacgagatc
gcgcggcggaagcttttcatcgagatcaccgaactcgatgtcaacgacgcgagctttccc
gacgacatcgcggcgcgcgatcaggccgtcgccgcaacatatcggcgcttccttcgcacc
gcgctggcaaatccggcggtgaggagcctcagcttctggcaactcggcgacggcgcaagc
tggtatttcgcgcagtcggtggacgagaacccgttgggccagcggcgcccgcgtccgctg
ctttacgatgccgacatgcggccgaaactcgctttcgatgcggtggcggatgaattgcgg
cgaatgcccgagcgccctcgcggctag

DBGET integrated database retrieval system