KEGG   Rhodomicrobium vannielii: Rvan_0845Help
Entry
Rvan_0845         CDS       T01353                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00521  Streptomycin biosynthesis
rva00523  Polyketide sugar unit biosynthesis
rva01130  Biosynthesis of antibiotics
Module
rva_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rvan_0845
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rvan_0845
Enzymes [BR:rva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rvan_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADP70121
JGI: Rvan_0845
UniProt: E3I1A8
Position
939071..939622
Genome map
AA seq 183 aa AA seqDB search
MLFQPALLEGAFMIEPEPFRDERGFFARTFCTREFEARGLVCNFVQHSISSTIRKGTVRG
MHFQTPPHGEVKVVTCTRGAIFDVIVDLRRAAPTFLRWQGFELTAENRRRLYIPEGFAHG
FQSLTDDVEVSYLISAFYAPESAGGVPHDDPLIGIEWPLSISSISEKDRNWPPFNASAAP
FPA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctatttcagccggccctgcttgagggcgctttcatgatcgaaccggaacccttccgc
gatgaaaggggctttttcgcccgcactttctgcactcgcgaatttgaagcgaggggtttg
gtgtgcaatttcgtgcagcactcgatatcctcgacgatccgcaagggcacggtgcgcggc
atgcatttccagacgccgcctcacggggaggtgaaagtggtgacatgcacccgcggcgcg
attttcgacgtgatcgtcgacctgcggcgcgccgcgccgacctttctcagatggcagggt
ttcgaactcaccgccgaaaaccgcaggcgcctctatattcccgagggcttcgcgcacggc
ttccagagcctgacggacgatgtcgaggtgtcctatctgatctcggctttctacgcgccg
gagagcgctggcggcgtccctcatgacgatccgctcatcggcatcgaatggccgctgtcc
atcagttcgatctccgagaaggaccggaactggccgccttttaatgcgtcggcagcgcca
tttcccgcgtga

DBGET integrated database retrieval system