KEGG   Rhodomicrobium vannielii: Rvan_0849Help
Entry
Rvan_0849         CDS       T01353                                 

Definition
NAD-binding 3-hydroxyacyl-CoA dehydrogenase protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rva  Rhodomicrobium vannielii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rvan_0849
   01212 Fatty acid metabolism
    Rvan_0849
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rvan_0849
   00650 Butanoate metabolism
    Rvan_0849
  Lipid metabolism
   00071 Fatty acid degradation
    Rvan_0849
   01040 Biosynthesis of unsaturated fatty acids
    Rvan_0849
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rvan_0849
   00310 Lysine degradation
    Rvan_0849
   00380 Tryptophan metabolism
    Rvan_0849
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rvan_0849
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rvan_0849
   00281 Geraniol degradation
    Rvan_0849
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Rvan_0849
Enzymes [BR:rva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rvan_0849
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rvan_0849
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rvan_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
942992..945010
Genome map
AA seq 672 aa AA seqDB search
MSADIANLKHWQYTIDLERIAWAVFDVKGQSHNTLGREQFAELDRIVTAVAHGAQDRTVR
GLVIMSGKDKSFIAGANIKEFDDLKTEEDVIEAVRAGTAVFDRIEALPVPVVAAINGACL
GGGLEFALACHYRIATREDATRIGLPEVKLGIIPGLNGSARWLRQAGPMSAMPPMLAGKL
LRPGQARAAGAVDQLVPTRHELKWAARKAVLKNAHSQPSRAWQPLLMFEPGRAFLANRMR
KETAAKVRAEHYPAPFRLIDLFEKHGGSFDDMKRAETKFFAPLMISDQSRNLRRVFRLSE
MLKAEAPKDGWRPARAHVIGAGTMGADIAMACVREGMEVSLQDNSPEAVEKALKRADAFF
KKRMRSPLEAEKAKARLLADPQGAQIHRADVVIEAIYENLDAKRAVFAEVEPKLKPGALL
ATNTSSLKIEDIASALQDPSRLIGLHFFNPVTVLPLVEVVKGADSREEEIRRGAAFVTRI
GKLPLIVKSSPGFLVNRTLAPYMFGAMQKLAEGTPKEKIDAAAEEFGMPVGPIELVDIVG
LDVALSVAKILKLPTPDDHPLMQLVAEKKLGKKTGEGFYKWVDGKREKPATAPNFAKADL
SVLGRELIAPLIDESEKALADGVVADADHVDAGAVFGAGFAPFRGGPLHYRASLKARENG
AAKTGGEPVHAG
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgatatcgcgaacctcaagcactggcagtacacgatcgatctcgaaaggatc
gcctgggcggtctttgacgtgaaggggcaatcgcacaatacgctcggccgcgagcagttc
gcggaactcgaccggatcgtgacggctgtggcgcacggcgcgcaggatcgcaccgtgcgc
ggcctcgtcatcatgtccggcaaggacaagagcttcatcgcgggcgcgaacatcaaggaa
ttcgacgacctcaagaccgaagaggacgtgatcgaggccgtgcgcgccggaaccgccgtg
ttcgaccgcatcgaggcgctgcccgtgccggtggtggccgcgatcaacggcgcgtgtctc
ggcggcggcctcgaatttgcgctcgcctgtcattaccgcatcgcgacgcgcgaggatgcc
acccgcatcggcctgcccgaggtgaagctcggcatcattccggggctgaacggctcggcg
cgatggctgcgccaggctggcccgatgagcgcgatgccgcccatgctcgcgggcaagctt
ctccggccggggcaggcgagggcggcgggtgccgtcgatcaactcgtgccgacgcgtcat
gagctgaaatgggcagcgcgcaaggccgtcctcaagaacgcacactcgcagccgtcgcgc
gcatggcagccgctcctgatgttcgagccggggcgcgccttcctcgcgaaccgcatgcgc
aaggaaaccgccgccaaggtgcgcgcggagcattatcccgcgccgttccgcctgatcgac
ctgttcgagaagcacggcggcagcttcgacgacatgaagcgcgccgagacgaaattcttc
gcgccgctgatgatttccgaccagtcgcgcaacctgcgccgcgtgttccggctgtccgag
atgctgaaagcagaagcgccgaaggatggctggcgtccggcgcgcgcgcatgtgatcggt
gcgggcacgatgggcgcggatatcgccatggcctgcgtgcgcgaaggcatggaggtttcg
cttcaggacaattcgcccgaggcggtggagaaggcgctgaagcgggcggatgcgtttttc
aagaagcgtatgcgctcgccgcttgaagccgagaaggcgaaggcgcggcttctggccgac
ccgcaaggcgcgcagatccaccgcgcggatgtggtgatcgaggcgatctacgagaacctt
gacgcgaagcgcgcggttttcgccgaggtcgagccgaagctgaagcccggcgcgctgctc
gccaccaacacctcgtcgctcaagatcgaggacatcgcatcagcgctgcaagatccgtcg
cgcctcatcggactgcatttcttcaaccccgtcaccgtgcttccgctcgtcgaggtggtg
aagggcgcggacagccgcgaggaggaaatccggcgcggcgcggccttcgtgacacgcatc
ggcaagctgccgctcatcgtgaaatcgtcgccgggcttcctcgtgaaccgcacgctcgcg
ccctatatgttcggcgcgatgcagaagctcgccgagggcacgccgaaggagaagatcgac
gcggcggctgaggaattcggcatgccggtcgggccgatcgagcttgttgatatcgtcggc
ctcgacgtggcgctgagcgtggccaaaattctcaagctgccgacgccggacgaccacccg
ttgatgcaactcgtcgctgagaaaaagctcggcaagaagacgggcgaaggcttctacaaa
tgggtggacggcaagcgcgagaagccggccaccgcgccgaatttcgccaaggccgatctt
tcggtgctcggccgcgagctgatcgcacccctgatcgacgagagcgagaaggcgctggcc
gatggcgttgtggcggatgccgatcacgtggacgcgggcgcggttttcggcgcgggcttc
gcgcccttccgtggcgggccgctgcattatcgcgcgtcgctgaaggcgagggaaaacggc
gcggcgaagacgggcggcgagcctgttcacgcgggatga

DBGET integrated database retrieval system