KEGG   Rhodomicrobium vannielii: Rvan_0866Help
Entry
Rvan_0866         CDS       T01353                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rva  Rhodomicrobium vannielii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rva00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
963119..964165
Genome map
AA seq 348 aa AA seqDB search
MKKEKPNAYYDAGAALQNAQAGGFPLTRLRRTRQAAWSRALVAENTLSASNLIWPIFVMD
GLRAKQPVPSLPGVDRMSVDLAAEAAEQAAELGVPAVALFPYTRPDLRDEAATEAFNPEN
VVCRAVRAIKARVPNMGIICDVALDPYTSHGQDGLMVGDEIVNDLSLEALTRQAMNQAEA
GCDVLAPSDMMDGRIGVIRSALESRGFYNTQIMAYSAKYASAFYGPFRDAVGSSGTLRGD
KRTYQMDPANSDEAIREVALDLAEGADMVMVKPGMPYLDIVRRVHEEFKVPTFVYQVSGE
YAMLLAAFQNGWLTRDKVILESLMAFRRAGASGILTYFAPEAARLLKA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagaaaaaccaaacgcatactacgacgcaggcgcagcgcttcagaatgcccag
gcgggcggttttcctctcacgcgcttgcgccggacgagacaggccgcatggtcgcgcgcg
ctcgtcgccgaaaacacgctttccgcatccaacctgatctggccgatcttcgtcatggac
ggcctgcgcgcgaagcagcccgttccgtcgcttccgggcgtcgaccgtatgtcggtggac
ctcgccgccgaagccgccgaacaggccgccgaacttggcgttccggctgtcgcgctcttt
ccctatacgcgccccgatctgcgcgacgaagcagccaccgaagccttcaatccagaaaac
gttgtctgccgcgcggtacgcgccatcaaggcccgcgtgccgaacatgggcatcatctgc
gacgttgcgttggacccctatacgagccacggccaggacggcctgatggtgggcgatgag
atcgtcaacgacctgtcgctcgaagcgctgacgcgtcaggcgatgaatcaggcggaagcc
ggttgcgatgtgctcgcgccgtcggacatgatggacggccgcatcggcgtaatccgctcg
gcgcttgagagccgcggcttctacaacacccagatcatggcctattcggcgaagtatgcc
agcgcgttctatggcccgttccgcgatgcggtcggctcgtccggcacgctcaggggcgac
aagcgcacctaccagatggacccggccaattccgacgaggcgattcgcgaagtggcgctc
gacctcgcagagggcgcggacatggtcatggtgaagcccggcatgccgtatctcgacatc
gtgcgccgcgtgcatgaggagttcaaggtgccgaccttcgtctatcaggtgtcgggcgaa
tacgcgatgctgctcgctgcgttccagaacggctggctcacccgcgacaaggtgatcctc
gaaagcctgatggcgttccgccgcgcgggcgcttcaggtatcctcacttatttcgcaccg
gaagccgcgcgactcttgaaggcgtaa

DBGET integrated database retrieval system