KEGG   Rhodomicrobium vannielii: Rvan_0906Help
Entry
Rvan_0906         CDS       T01353                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rvan_0906
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rvan_0906
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rvan_0906
Enzymes [BR:rva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rvan_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1011236..1012054)
Genome map
AA seq 272 aa AA seqDB search
MHRLATVFEELAAQDRKAFVTFITAGDPDTATSLEILKGLPGAGADVIELGMPFSDPMAD
GPAIQRASLRALHAGQDMHKTLAMVRAFRETNKTTPIVLMGYYNPIYVYPVDSFLADAVE
AGVDGLIVVDAPPEADDELCIPALNAGLNFVRLTTPTTDDHRLGAVLANTSGFVYYVSIT
GVTGTRAPDLEAVAKNVARIKARTRLPVAVGFGVRTPEQAKSIASVADGVVVGSAIVDAI
AQSLDDKGRATELTVSSVLTLVEKLSAGLKAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggctcgcgacagtcttcgaagaattggcggctcaagaccgcaaggctttcgtc
accttcattacggctggcgatcccgacaccgccacgtctctcgaaatcctcaagggtctg
ccgggggcgggcgcggatgtcatcgaacttggcatgccgttctccgaccccatggcggac
ggcccggcgatccagcgcgcgtcgctgcgggcgctgcacgccggtcaggacatgcacaag
acgctcgccatggtgcgcgccttccgcgagacgaacaaaacgacgcccattgtgcttatg
ggctactacaaccccatatacgtctatccggtggatagtttcctcgccgacgcggtcgag
gcgggcgtcgacgggctgatcgtggtcgacgcgccgccggaagcggacgacgagctttgc
atcccggccctgaacgccggattgaatttcgttcgcctcacaacgccgacgacagacgac
catcgcctcggcgccgtactcgcgaacacgagtggcttcgtctattacgtgtcgatcacg
ggcgtgaccggaacgcgcgcgcccgacctcgaagcggtggcgaagaacgtggctcgcatc
aaggcgagaaccaggcttcccgtcgcggtcggctttggtgtgcgcacgcccgaacaggcg
aagtccatcgcgagcgtcgccgacggtgtcgtcgtcggctccgcgatcgtagatgccatc
gcccagagccttgacgacaaggggcgtgcgaccgaactaaccgtaagctccgtgctcaca
ctggtcgaaaagctctccgccggcctgaaggcagcctga

DBGET integrated database retrieval system