KEGG   Rhodomicrobium vannielii: Rvan_0906Help
Entry
Rvan_0906         CDS       T01353                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00260  Glycine, serine and threonine metabolism
rva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rva01100  Metabolic pathways
rva01110  Biosynthesis of secondary metabolites
rva01130  Biosynthesis of antibiotics
rva01230  Biosynthesis of amino acids
Module
rva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rvan_0906
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rvan_0906
Enzymes [BR:rva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rvan_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA Tmemb_14
Motif
Other DBs
NCBI-ProteinID: ADP70182
JGI: Rvan_0906
UniProt: E3I1W3
Position
complement(1011236..1012054)
Genome map
AA seq 272 aa AA seqDB search
MHRLATVFEELAAQDRKAFVTFITAGDPDTATSLEILKGLPGAGADVIELGMPFSDPMAD
GPAIQRASLRALHAGQDMHKTLAMVRAFRETNKTTPIVLMGYYNPIYVYPVDSFLADAVE
AGVDGLIVVDAPPEADDELCIPALNAGLNFVRLTTPTTDDHRLGAVLANTSGFVYYVSIT
GVTGTRAPDLEAVAKNVARIKARTRLPVAVGFGVRTPEQAKSIASVADGVVVGSAIVDAI
AQSLDDKGRATELTVSSVLTLVEKLSAGLKAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggctcgcgacagtcttcgaagaattggcggctcaagaccgcaaggctttcgtc
accttcattacggctggcgatcccgacaccgccacgtctctcgaaatcctcaagggtctg
ccgggggcgggcgcggatgtcatcgaacttggcatgccgttctccgaccccatggcggac
ggcccggcgatccagcgcgcgtcgctgcgggcgctgcacgccggtcaggacatgcacaag
acgctcgccatggtgcgcgccttccgcgagacgaacaaaacgacgcccattgtgcttatg
ggctactacaaccccatatacgtctatccggtggatagtttcctcgccgacgcggtcgag
gcgggcgtcgacgggctgatcgtggtcgacgcgccgccggaagcggacgacgagctttgc
atcccggccctgaacgccggattgaatttcgttcgcctcacaacgccgacgacagacgac
catcgcctcggcgccgtactcgcgaacacgagtggcttcgtctattacgtgtcgatcacg
ggcgtgaccggaacgcgcgcgcccgacctcgaagcggtggcgaagaacgtggctcgcatc
aaggcgagaaccaggcttcccgtcgcggtcggctttggtgtgcgcacgcccgaacaggcg
aagtccatcgcgagcgtcgccgacggtgtcgtcgtcggctccgcgatcgtagatgccatc
gcccagagccttgacgacaaggggcgtgcgaccgaactaaccgtaagctccgtgctcaca
ctggtcgaaaagctctccgccggcctgaaggcagcctga

DBGET integrated database retrieval system