KEGG   Rhodomicrobium vannielii: Rvan_0907Help
Entry
Rvan_0907         CDS       T01353                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rva  Rhodomicrobium vannielii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rvan_0907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rvan_0907
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rvan_0907
Enzymes [BR:rva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rvan_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1012088..1013323)
Genome map
AA seq 411 aa AA seqDB search
MDPIAETPLHLNSYRTGPDERGHFGLYGGRFVAETLMPLILELEAAYEAAKVDPAFHAEL
ADLNAHYAGRPSPLYFAERLTQHLSGAKVYFKREELNHTGSHKVNNCLGQILLAKRMGKK
RIIAETGAGQHGVATATVAARFGLPCVIYMGATDIERQKPNVFRMRLLGAEVRPVISGTG
TLKDAMNEALRDWVSNVEDTFYIIGTVAGPHPYPAMVRDFQAVIGQETREQMLAAEGRLP
DTLVAAIGGGSNAMGIFHPFLDDPSVKMFGVEAAGRGLDVPNGHCASLNGGKPGVLHGNR
TYLLQDGDGQILEGHSISAGLDYPGIGPEHSWLRDTGRVTYVSATDREALDAFQLCTRIE
GIIPALEPAHALAYVTKLAPTLPPDDLLVMNMSGRGDKDIFAVAGHLGMDI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggaccccatcgctgaaacgccgctgcatctgaacagttaccgcaccggcccggacgaa
aggggtcatttcgggctttacggcggacgctttgttgccgaaacgctgatgccgctcatc
ctcgaactcgaagcggcgtatgaggcggccaaggtcgatcccgcatttcacgcggaactc
gcagacctcaacgcccattacgcaggccggcccagcccgctctacttcgcggaacggctc
acgcagcacctcagcggcgcgaaggtgtacttcaagcgcgaggaactgaatcataccggc
tcgcataaggtaaacaactgcctcggccagatcctgctggcgaagcgcatgggcaaaaag
cgcatcatcgcggaaacgggcgcgggccagcacggcgtcgcgacggccacggtggccgcg
cgtttcggcctgccttgcgtgatatacatgggcgcgacggacatcgaacggcagaagccg
aacgtgtttcgcatgcggcttctcggcgcggaagtgcggccggtcatctcgggcaccggc
acgctgaaagacgccatgaacgaggcgttgcgcgattgggtgtcgaatgtcgaggacacg
ttctacatcatcggcacggtggccggtccgcatccctatcccgccatggtgcgcgatttt
caggccgtcatcgggcaggaaacccgcgagcagatgcttgcggcggaaggccgcctgccg
gatacgctggttgcggccatcggcggcggctcgaatgcgatgggtattttccaccccttc
ctcgacgatccgagcgtaaagatgttcggcgtggaagccgcgggcaggggcctcgatgtg
ccgaacgggcattgcgcctcgctcaacggcggcaagcccggcgtgctgcacggcaaccgc
acctatctgctgcaggacggcgacggccagatccttgaaggacattcgatctcggcgggc
ctcgattatccgggcatcgggcccgagcatagctggctgcgcgacaccggccgcgtgacc
tatgtatcggcgacggaccgcgaggcgctggatgcgttccagctgtgcacgcggatcgag
ggcatcatccccgcgctcgaacccgcccacgcgctcgcctatgtgacaaaacttgccccc
accttgccgccggacgatctcctcgttatgaacatgagcggacggggcgacaaggacatc
ttcgccgttgccggtcatctcggaatggacatctag

DBGET integrated database retrieval system