KEGG   Rhodomicrobium vannielii: Rvan_0924Help
Entry
Rvan_0924         CDS       T01353                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00920  Sulfur metabolism
rva01100  Metabolic pathways
rva01120  Microbial metabolism in diverse environments
rva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rvan_0924
Enzymes [BR:rva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Rvan_0924
Transfer RNA biogenesis [BR:rva03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Rvan_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ADP70200
JGI: Rvan_0924
UniProt: E3I2B6
Position
complement(1030796..1031638)
Genome map
AA seq 280 aa AA seqDB search
MSFDASDIRELGLWGLPLAQRAGAVIMDIYTTSPEVRYKADRSPVTDADVACEHIILKAL
SRLAADIPVVAEEALSCGAAPKIEDRFFLVDPVDGTKEFIRANGEFTVNIALVENHAPVF
GLVYAPAFSDCYVTLGTDRAVRVKLVPDHHPEPRPDYAFEPISGERPGSRDFTAIVSRSN
QTPEAERFIRRIGGPPCMRMGSSLKFGVLARGDADVYPRFAPTSEWDIAAGQALVNAAGG
CVLTEAGAPLAYGKVDRHFANPSFIAWRRRDEAEAMLRAE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttcgacgcgtccgacatacgtgaactcgggctatggggtctccccctcgcgcag
cgggcgggcgccgtcatcatggacatctatacgacgagtcccgaggtgcgctacaaggcg
gaccgctcgcccgttaccgacgcggatgtcgcctgcgaacatataatcctcaaggctctt
tcgaggctggccgccgatattccggttgtcgcggaggaggcgctgtcgtgcggcgcagcg
ccgaagatcgaagatcgcttcttcctcgtcgatccggttgacggcacgaaggagttcatc
cgggcgaacggcgagttcacggtcaacatcgcgctggtggagaatcacgccccggtgttc
ggcctcgtttatgcgcccgcgttctcggactgctacgtgacgctcgggaccgaccgcgcg
gtgagggtgaagctcgtgccggaccatcatcccgagccgcgcccagactacgcattcgag
cctatctccggcgagcggccggggtcgcgcgacttcacggccatcgtcagccgctcgaat
cagacgcccgaagccgagcgttttatccggcgcatcggcggtccgccgtgcatgcgcatg
ggatcgtcgctcaagttcggcgttctcgcgcggggagacgccgatgtgtatccacgcttt
gcgccgacgtccgaatgggacatcgcggcgggccaagcgctggtgaacgcggctggcggg
tgtgtgctcaccgaagcgggcgcgccgctcgcttacggcaaggtcgaccgccacttcgct
aacccgtccttcatagcgtggcggcggcgcgacgaggccgaggcgatgcttcgggccgag
taa

DBGET integrated database retrieval system