KEGG   Rhodomicrobium vannielii: Rvan_0996Help
Entry
Rvan_0996         CDS       T01353                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rva  Rhodomicrobium vannielii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rvan_0996
Enzymes [BR:rva01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rvan_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1102813..1106589)
Genome map
AA seq 1258 aa AA seqDB search
MQKRTSAASSTPVRFVIVTLDSHLASAVERAKETLADELPGLRITLHAASEWGQNPELLD
ECLDDIREGDIILTTMLFIEEHIKAVLPALEARRDHCDAMIACMSASEVARVTKMGGFNM
DGSDKGVLSLLKKLKPKKKEGESQPANAGAKQMAMLRRLPKILRFIPGAAQDVRAYFLTL
QYWLAGSDDNIAHMVRYLVNRYASGPRQALRGKISAAEPVEYPEVGVYHPTLKHRVGHSI
DELPHAKGSDKGTVGVLVMRSYVLAGNSLHYDGMIETLEKRGLNVIPVFASGLDAREAIE
RYFIENGSAKIDALVSLTGFSLVGGPAYNDAKGAQEILAKLDVPYISVQPVEFQTLQQWA
GDVRGLMPVESTMMVAIPELDGATGPAVFGGRSDCTDAPCSGCELGCVFPTSTARDMHSC
VERAEMISSRIERLIALRKSERAERKLGVVMFCFPPNAGNIGTAMSLAVFESLYNTLTRL
KAEGYTVEVPESVDALRERVIGGNSARYGTPANVLARIPVNDYIRAEKWLPQIEKAWGSA
PGRQQTDGATVFVLGETFGNVFVGIQPAMGYEGDPMRLLFERGFAPTHAFSAFYRWLRDD
FGVHALLHFGTHGALEFMPGKQTGLSGDCWPDRLIGDLPNFYLYAANNPSEGTLAKRRSA
ATVVSYLTPPVTQAGLYRGLLDLKASVQRWREFVPDTAEAEKEALATLIQAQAAAVDLAE
AEPQWPAADVEGKVAALINAVIELEETLIPHGLHVVGKTATDDERRDLLTFAAEALDGFS
PPHDLIRAVAGGQSPEDALKRAGLERSEQNIGKLAKLAQMYNYLGEDAELPAIVRALDAR
YIKPVAGGDIIRNPDILPTGRNIHGFDPFRIPSVFAMKEGEKQAARLLDRHMAEGNALPE
SVAFVLWGTDNLKTEGEPIAQALALMGARPRLDSYGRVSGASLVPLEELGRPRIDVVMTM
SGIFRDLLPLQMKLLAEASYEAAIADEPLDKNFIRKHALAYQASQKCDMETAALRVFSNG
DGAYGANVNLLVDSGAWQDEDELAETYSRRKSFAYGRQGKPMAQPALLKTMLADVDLAYQ
NLDSVDLGVTTIDQYFDTLGGITRSVRRAKGGKDLPVYIADQTRGEGKVRTLSEQVSLET
RTRALNPKWYEGMLEHGYEGVRQIEATVTNTMGWSATTGQVDPWVYQRLTQTYVLDETMR
KRLAALNPTATARMVNRLNEAYERNYWKPDDETLDALRKASEELEDQIEGVGMVEEAA
NT seq 3777 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcgcacttcagccgctagcagcacaccagtgcgcttcgtcattgtaacgctc
gacagccatctggcgagcgcggtcgagcgcgccaaggagacgctggcagacgagttgccg
ggccttcgcatcacgcttcacgccgcgagcgagtggggccagaacccagagcttctcgac
gagtgcctcgacgacatccgcgagggcgacatcatcctcacgacgatgctgttcatcgag
gagcacatcaaagcggtgttgcctgcgctcgaagcgcgccgcgaccattgcgacgccatg
atcgcttgcatgtcggcaagtgaagttgcgcgcgtcaccaagatgggcggcttcaacatg
gacggctccgacaagggcgtcctgtcgctgctgaagaaactgaagccgaagaagaaggaa
ggcgagagccagcccgcgaacgccggcgcgaaacagatggcgatgctccgccgcctgccg
aagatcctgcgcttcatccccggcgccgcgcaggacgtgcgggcgtacttcctcacgctg
caatactggctcgcaggctccgacgacaacatcgcgcacatggtgcgctacctcgtgaac
cgctatgcgagcggcccgcgtcaggcgctgcgcggcaagatcagcgcggcggagccggtg
gaatatccggaggtcggcgtctaccatccgacgctgaagcatcgcgtcggccacagcatc
gacgaactgccgcacgcaaagggcagcgacaagggcaccgttggcgtgctcgtcatgcgc
tcctatgtgctcgcgggcaattcgctgcattacgacggcatgatcgagacgctggaaaag
cgcggcctgaacgtgatccccgtcttcgcgagcggcctcgacgcgcgcgaggcgatcgag
cggtacttcatcgagaacggcagcgcgaagatcgacgcgctcgtgtcgctcacgggtttc
tcgctcgtcggcggcccggcctacaacgacgcgaagggcgcgcaggaaatcctcgccaag
ctcgacgttccttatatctccgtccagccggtggaattccagacgctccagcaatgggcg
ggcgacgtgcgcggcctcatgccggtggaaagcaccatgatggtggcgatccccgagctt
gacggcgccacgggtccggcggtgttcggcggccgttccgactgcaccgacgcgccgtgc
tccggttgcgaactcggctgcgtcttcccgacctcgaccgcgcgcgatatgcattcctgc
gtcgagcgcgccgaaatgatttcttcgcgcatcgagcgtctgatcgcgcttcgcaagagc
gagcgtgcggagcgcaagctcggcgtggtgatgttctgcttcccgccgaacgccggcaat
atcggcacggcgatgtcgcttgcggtgttcgagtcgctctacaacacgcttacgcgactg
aaggccgagggctatacggtcgaggtgccggagtcggtcgatgcgctgcgcgagcgcgtc
atcggcggcaattcggcccgctacggcacgcccgccaacgtgctcgcccgcatcccggtc
aacgattacattcgcgccgagaagtggctgccgcagatcgaaaaggcgtggggttccgcg
ccaggccgccagcagaccgatggcgcgacggtgttcgtgctcggcgagacgttcggcaat
gtgttcgtcggcattcagcccgcgatgggctacgagggcgacccgatgcggttgctgttc
gaacgcggtttcgcgccgacgcatgccttctcggccttctaccgctggctgcgcgacgat
ttcggcgtgcacgcgctcctgcatttcggcacgcatggcgcgctcgaattcatgccgggc
aagcagaccggcctttcgggcgattgctggccggaccgcctcatcggcgacctgccgaac
ttctatctctatgccgcgaacaacccgtccgaaggtacgctcgcgaagcgccgcagcgcc
gcgacggtcgtcagctatctgacgccgcccgtcacgcaggctgggctttatcgcgggctg
ctcgacctcaaggcttcggtgcaacgctggcgcgagttcgtgcccgacacggccgaagcc
gagaaggaagcgctggcgacgctcattcaggcgcaggccgctgccgtcgatctggctgag
gccgagccgcaatggcccgccgccgatgtcgagggcaaggttgcggcgctcatcaatgcc
gtgatcgagcttgaagagacgttgattccgcacggcctccacgtcgtcggaaagaccgcg
accgacgacgagcggcgcgatcttctgaccttcgccgccgaggcgctcgacggtttcagc
ccgcctcacgacctgatccgcgccgtagcgggcggccagtcgcctgaggatgcgctgaaa
cgcgccggcctcgaacgctccgagcagaacatcggcaagctcgcaaagctcgcgcagatg
tacaattatcttggcgaggacgcggaactgcccgccatcgtgcgcgcgctcgacgcccgc
tatatcaagcctgtcgcgggcggcgacatcatccgcaatcctgacatcctgcccaccggc
cgcaacatccacggcttcgaccccttccgcatcccgagcgtattcgcgatgaaggaaggc
gagaaacaggccgcgcggcttctcgaccgccacatggcggagggcaacgcgctacccgaa
tcggtcgcgttcgtgctgtggggcaccgacaacctcaagacggaaggcgagccgattgcg
caggctctggcgctcatgggcgcgcgtccacgcctcgacagctatggccgcgtgtccggt
gcctcgctcgtgccgcttgaagaactcggccgaccgcgcatcgacgtggtgatgaccatg
tcgggcatcttccgcgacctgcttccgctgcagatgaagctcttggcggaagcgtcctac
gaggccgccatcgcggacgaaccgctcgacaagaatttcatccgcaaacacgcgctcgcc
tatcaggcgtcgcagaaatgcgacatggaaacagccgcgctgcgcgtcttctcgaacggc
gacggcgcttacggcgcgaatgtgaacctgctcgtcgattcgggggcatggcaggacgag
gacgaactcgccgaaacctacagccgccgcaagtccttcgcctatgggcggcagggcaag
ccgatggcgcaacccgcgctgctgaaaaccatgctcgccgacgtcgatctcgcctatcag
aacctcgattcggtcgatctcggcgtgacgaccatcgaccagtatttcgatacgctgggc
ggcatcacgcgctcggtcaggcgcgcgaagggcggcaaggatctgccagtctatatcgcc
gaccagacgcgcggcgagggcaaggttcgcacactgtccgagcaggtttcgctggaaacg
cgcacgcgcgctctcaacccgaaatggtacgagggcatgctggagcacggctatgaaggc
gtgcgtcagatcgaagcgacggtcaccaacacgatgggctggtcggcaacgacagggcag
gtcgatccgtgggtctatcagcgcctgacgcaaacctatgtgcttgacgagacaatgcga
aagcggctagcggccttgaacccgacggccaccgcgcgcatggtgaaccgcctgaatgaa
gcttacgaacgcaactactggaagccggacgacgagaccctcgatgctcttcgcaaggcg
tctgaagaactcgaagaccagatcgaaggggttggtatggtagaggaagccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system