KEGG   Rhodomicrobium vannielii: Rvan_1007Help
Entry
Rvan_1007         CDS       T01353                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
rva  Rhodomicrobium vannielii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rva00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rva02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1117279..1117656)
Genome map
AA seq 125 aa AA seqDB search
MKAIKIAMVGAALVWSASAYAAGDPVKGEQVFKQCKICHQVGPTAKPGVGPVQNNVVGSK
AGSRPGFNYSDAMKNSGLTWDEATLDKYLENPKAVVPGTKMVFVGLKNPQDRADVIAFLA
TQHGQ
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctatcaaaatcgctatggtcggcgcggccctcgtctggtcggcttcggcttat
gccgccggcgatccggtgaagggtgagcaggtcttcaagcagtgcaagatctgtcatcag
gttggcccgacggcgaagccgggcgtcggccccgtgcagaacaatgtcgtcggttcgaag
gctggctcgcgcccgggcttcaactattccgatgccatgaagaactcgggcctgacgtgg
gacgaagccaccctcgacaagtatctcgagaacccgaaggccgttgttccgggcacgaag
atggtgttcgtcggtctgaagaacccgcaggatcgcgcggacgtcatcgcgtttcttgcg
acgcagcacggccagtaa

DBGET integrated database retrieval system