KEGG   Rhodomicrobium vannielii: Rvan_1038Help
Entry
Rvan_1038         CDS       T01353                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00790  Folate biosynthesis
rva01100  Metabolic pathways
Module
rva_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rvan_1038
Enzymes [BR:rva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rvan_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADP70312
JGI: Rvan_1038
UniProt: E3I318
Position
complement(1151854..1152516)
Genome map
AA seq 220 aa AA seqDB search
MERKASAPVPPLREPQTGLRASADSQRPSREEAEAAVRTLLAWTGDDPTREGLIDTPKRV
VDSYAEYFWGYDGDPVDELSRTFEDVQGYDDIVMLRDIDFASHCEHHMVPIIGVAHVAYI
PDRRIVGISKLARVVDIYAKRLQTQETMTAQIANCIQDALKPKGVAVMIDALHQCMTMRG
VHKKGTTTITTRFTGVFSEDKAERDRFMQLVNGTRVLASR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaaaagcgtcagcgccggtaccgccattgcgggaaccgcagaccggcttgcgc
gcatcggctgactcgcaacgtccttcgcgcgaggaagcggaagccgccgtccgcacgctc
ctcgcatggacgggcgacgatccaacccgcgaagggctgatcgatacgccgaagcgcgtc
gtcgattcctatgccgaatatttctggggctatgacggcgatccggtggatgagctttcg
cgcaccttcgaggacgtgcagggctatgacgacatcgtcatgctgcgcgacatcgatttc
gcgtcgcattgcgagcatcacatggtgccgatcatcggggtcgcgcatgtggcctacatc
cccgatcggcgcatcgtcggcatttcaaagctcgcgcgggtggtcgacatctacgccaag
cgcttgcagacgcaggaaacgatgacggcccagatcgcgaattgcattcaggatgcgttg
aagccgaagggcgtcgccgtgatgatcgacgcgctgcatcagtgcatgacgatgcgcggt
gtgcacaaaaagggcacgacgacgatcaccacgcgcttcaccggtgtcttcagcgaagac
aaggccgagcgcgaccgcttcatgcaacttgtgaacggcacgcgcgttctggcgagccga
tga

DBGET integrated database retrieval system