KEGG   Rhodomicrobium vannielii: Rvan_1130Help
Entry
Rvan_1130         CDS       T01353                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rva  Rhodomicrobium vannielii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rvan_1130
Enzymes [BR:rva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rvan_1130
Exosome [BR:rva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rvan_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1244689..1246887
Genome map
AA seq 732 aa AA seqDB search
MTEASWRVREEDVSKIASATHGDPFSVLGLHRAGNGMAIRAFVPGVERLGAVLESGVTVP
LERRGFGDFFEAFVPGAAERFRYRLRAVIAGHALDFQDPYEFGPVLGPMDDYLLVEGTHK
RLYERLGSHPIHHEGADGVLFAVWAPHARRVSVVGDFNQWDGRRHTMRKRVDSGIWELFA
PGIDEGTVYKYEIIGVNGDIQPLKADPFGFSGEMRPSTASVVARTDGHKWGDEAHMAWRP
TVEARRGPMSVLEVHASSWRRKWDGGFLSYDELADQLIPYAVDMGFTHIELMPISEHPLD
ASWGYQPIGLFAPTRRFGDPAGFQRFVDGAHRVGLGVILDWVPAHFPTDEHGLAKFDGTA
LYEHPDPRRGFHPDWNTAIYDFGRAEVASMLVSNAIYWLDRYHIDGLRVDAVASMLYLDY
SRKAGEWLPNPDGSNQNHDAVRFLQDANASVYGTYPGIATIAEESTSWPGVSQPTSAGGL
GFGFKWNMGWMNDTLSYIALDPVYRKYHHHKLTFGLLYAFSENFILPISHDEVVHGKGSV
LGKMPGDDWQKFANVRGYYGFMWGYPGKKLLFMGQEFAQRAEWNFDAGLDWWSLDHASHR
GVQSLVRDLNRLHREKPALHARDCEPEGFQWIVVDDEAQSVFAWVRYGGPGAKPVLVASN
FTPEPRYNYRIGLPFAGRWREILNTDAPEYGGAGIGNFGEVHASMQESHGLPASAEITLP
PLATVYFEHDSV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaagccagctggcgagtgcgagaagaggacgtttcaaagatcgcgtccgccacg
catggcgatcccttctccgtgctaggcctgcatcgcgcaggcaacggaatggcgattcgc
gctttcgtgccgggcgtcgagcgtctcggagccgtcctcgaaagcggcgtgacagtcccg
ctggagcggcgcggcttcggcgacttcttcgaggccttcgttccgggagcggcggagcgc
tttcgctatcggctccgcgcggtgatcgccggacacgcgttggactttcaggatccttac
gagttcggccctgtgcttggcccgatggacgattacctgctcgtcgaaggcacacacaag
cggctttatgagcggcttggctcgcatccgattcaccatgagggcgctgacggcgtgctg
ttcgcggtctgggcgccgcacgcacgccgcgtctctgtcgtcggcgacttcaaccagtgg
gacggtcgccgccacacgatgcgcaagcgcgtcgacagcggcatctgggagttgttcgcg
cccggcatcgacgagggcaccgtctacaaatacgagataatcggggtgaacggcgatatt
cagccgctcaaggccgatccgttcggcttctccggtgagatgcgcccctccaccgcctcc
gtcgtcgcgcgaaccgacggccataaatggggcgacgaagcgcatatggcctggcggccg
acggtcgaagcccgccgcgggccgatgtcggtccttgaggtgcacgccagttcgtggcgg
cgcaaatgggacggcggtttcctgtcctacgacgagcttgcggaccagctcattccctat
gccgtggacatgggcttcacgcatatcgagctcatgccgatttcggagcaccctctcgac
gcatcatggggctaccagcccatcgggcttttcgctccgacgcggcgcttcggcgacccg
gcgggcttccagcgcttcgtcgatggcgcgcaccgggtaggtctcggcgtaatcctcgac
tgggtgcccgcgcatttcccgaccgacgagcacgggcttgcaaagttcgacggcacggcg
ctgtacgagcatcccgatccgcgtcggggcttccatcccgactggaacacggcgatctac
gatttcggccgcgccgaagtcgccagcatgctcgtctccaacgcgatctactggctcgac
cgctaccacatcgacggcctgcgggtggatgcggtcgcgtccatgctctatctcgactat
tcgcggaaagcgggcgaatggctgccgaacccggatggcagcaaccagaaccacgacgcc
gtgcggttcctccaagacgcgaatgcaagcgtctacggcacctatcccggcatcgcgact
atcgccgaggaatcgacctcttggcccggcgtgtcgcagccgacaagcgcgggcggcctc
ggcttcggcttcaagtggaacatgggctggatgaacgacacgctgtcgtacatcgcgctc
gatccggtctaccgaaaatatcaccatcacaagctcaccttcgggctgctctacgccttc
tccgaaaacttcatcctgccgatcagccacgacgaggtggttcacggcaagggctcggtg
ctcggcaagatgcccggcgacgattggcaaaaatttgccaatgttcgcggctattacggg
tttatgtggggctatccggggaaaaaacttctcttcatggggcaggaatttgcgcagcgg
gccgagtggaatttcgacgcggggctggactggtggtcgctcgaccatgcgtcgcatcgc
ggggtgcaatcgctggtccgcgatctgaaccgcctccatcgcgagaagcccgcgctccat
gcgcgcgactgcgagccggagggcttccagtggatcgtggtcgacgacgaggcgcaatcc
gttttcgcatgggtgcgctatggcggaccgggcgcgaagccggtgctggtcgcgtccaac
ttcacgccggaaccgcgctataattatcgcatcgggctgcccttcgccgggcgctggcgc
gaaattctcaacacggatgcgccggagtatggcggtgcgggtatcggcaatttcggcgaa
gtccacgcttcgatgcaggagagccacggtttgcccgcatcggcggaaatcactctgcca
cccctcgcaactgtttatttcgaacatgactcggtttag

DBGET integrated database retrieval system