KEGG   Rhodomicrobium vannielii: Rvan_1203Help
Entry
Rvan_1203         CDS       T01353                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
rva  Rhodomicrobium vannielii
Pathway
rva00790  Folate biosynthesis
rva01100  Metabolic pathways
Module
rva_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rvan_1203
Enzymes [BR:rva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rvan_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADP70472
JGI: Rvan_1203
UniProt: E3I4F7
Position
complement(1330288..1331349)
Genome map
AA seq 353 aa AA seqDB search
MPGLYLEPTGFLYGEIARQAIAAGEALPLAGSPRIAFSAARLQEGGPGGIRNIFLRASAL
PQLSEPRVKDLLARIIEPRADIAGVPMDGPRIMGILNVTPDSFSDGGYHFATDAALAHAA
DLVRHGTDFIDVGGESTRPGSDPVDVEEEVRRILPVLEGLAAWQTPVSVDTRRPEVMRAV
AGARLDIINDVSALTFSSDSLSTAAELRKPVVLMHAKGDPKTMQDAPSYADVVTDVFDWL
EARIEAAVAAGIDRAKIVADPGIGFGKTLAHNAALLRSIALFHGLGVPLLVGTSRKRSLQ
RVAVAELPGDIDAASVAAALDAASRGVQIVRMHNVGATAQALAVWRWLNGRNP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcccggactttatctggaaccgaccggcttcctttatggcgagattgcgcgccaggcg
attgcggcgggcgaggcgctgccgcttgccggaagcccgcgcatcgcgttctcggcggcg
cggcttcaggagggcgggcccggcggcatccgcaacatctttctgcgcgcatcggccctg
ccgcagctgagcgagccgcgtgtgaaagatctgctcgcgcgcatcatagaaccccgcgcc
gacatcgcaggcgtgccgatggacggcccgcgcatcatgggcattctgaacgtcacgccg
gacagcttttcggatggcggctaccattttgcgacggatgcggcgttggcgcatgcggcg
gatctggtgcggcatggcaccgactttatcgatgtcggcggggaatcgacgcggcccggt
tccgatccggtggacgtcgaggaagaggtgcgacgcatcttgcccgtgctcgaaggactc
gccgcatggcagacgccggtctccgtggatacgcgacgccctgaagtcatgcgcgcggtg
gcgggagcgcggctcgacatcatcaacgacgtgtccgcgctcaccttttcaagcgacagc
ctttccacggcggccgaactccgcaagcccgtggtgctgatgcacgccaagggcgatccg
aaaacgatgcaggacgcgccgtcctacgccgacgtcgtgaccgatgttttcgactggctc
gaagcgcggatcgaggcggcggttgcggcggggatcgaccgcgcgaagatcgtcgcggac
ccgggcatcggctttggcaagacgctcgcccacaacgcggccctgctgcgaagcatcgcg
ctgttccacggtctcggcgtgccgctgctcgtaggcacttctcgcaagcggtcgcttcag
cgcgtggcggtggccgagcttccgggcgacatcgacgccgcgagcgttgctgcagccctc
gacgcggcctcgcggggcgtgcagatcgtccgtatgcataatgtcggagccacggcgcag
gcgctcgcggtctggcgctggctcaacggccgcaatccatag

DBGET integrated database retrieval system